SecReT6
Effector Protein ID: 50123196
-
SecReT6 ID40
T6SS typeA1
Gene symbol-
Locus tagECA4276
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T6SS(s) in this replicon]
Location [Strand]4790693..4792522 [+]
ProductRhs-family protein
Effector typeProtein
Homologous effectorECA3427
Descriptiontype VI secretion system Vgr family protein
UniProt IDQ6CZ77
KEGG IDeca:ECA4276
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.10E-66, Aligned region: 30..328
Phage_base_V [PF04717], Evalue: 1.40E-22, Aligned region: 367..459
Gp5_C [PF06715], Evalue: 4.80E-06, Aligned region: 501..523
Gp5_C [PF06715], Evalue: 4.80E-06, Aligned region: 516..538
Gp5_C [PF06715], Evalue: 4.80E-06, Aligned region: 549..565
Protein Sequence: 609 a.a.     [Download]
>gi|50123196|ref|YP_052363.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MANSTGLQFTVKVGALPAPTFAVVDFQLSEALNRPFALSLNLASALPDVDFGAVLDQPCELLVWYEGELK
RRVSGIISAFAQGDTGFRRTRYQMEVRPALWRLGLRTNARIFQAQKPEAIIGTLLEEAGITDYAFALRHE
HAPREYCVQYRESDLAFVTRLAAEEGLYFFHEFEEGKHRVIFADDAGALAKGPELFFNLANQGLSEGDYV
RRFRYAETVSTAEVALKDYSFKTPAYSLLHSKISGKLDHQRESYQHYDYPGRFKQDPSGKAFTGYRLDAL
RANAMAGSGESNAAMLMPGNSFTLTEHPNPVLNTGWQLVAIIHSGQQPQALEEESGGEPTTYSNSFEVIS
AKSTWRADLPYKPMVDGPQIATVVGPAGEEIYCDEYGRIKLQFPWDRYGSSDDQSSCWVRVSQGWAGGQY
GLIAIPRIGHEVIVSFLEGDPDQPIVTGRTFHATNPSPYPLPANKTRTSLRTSTHKGAGFNELRFEDQAG
QEEVFIHAQKDMNTVVLNNRTTSVAADHTESVGGNQAMSVVKDQSTEIQGHQNIAVTKNRSTTVDDNDSL
QVKNNIAIQSQEGDILIATKGGFIGISADGVINIKGSHIVVNGQQIDLN
-
Nucleotide Sequence: 1830 bp     [Download]
>gi|50118965|ref|NC_004547.2|:4790693-4792522 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
GTGGCAAACAGTACAGGATTACAGTTCACGGTAAAGGTCGGTGCATTGCCCGCCCCGACGTTTGCGGTGG
TGGATTTTCAGCTCAGCGAGGCGCTTAACCGGCCATTTGCCTTGTCGCTGAATCTGGCAAGTGCCTTGCC
GGATGTGGATTTCGGTGCGGTGCTCGACCAACCGTGTGAGTTGCTGGTGTGGTACGAAGGCGAACTAAAG
CGCCGAGTGAGCGGGATTATCAGCGCCTTTGCGCAGGGGGACACGGGCTTTCGTCGCACGCGCTATCAGA
TGGAAGTCCGTCCGGCCTTGTGGCGACTGGGATTACGTACCAACGCCCGCATCTTTCAGGCGCAAAAGCC
GGAAGCGATTATCGGCACACTGCTGGAAGAAGCAGGGATTACCGACTACGCCTTTGCGCTGCGTCATGAG
CACGCGCCCCGGGAATACTGCGTGCAATATCGGGAAAGCGATTTGGCGTTTGTCACCCGACTGGCCGCAG
AGGAAGGGTTGTACTTCTTTCACGAGTTTGAAGAAGGCAAACACCGAGTCATCTTTGCCGATGATGCAGG
CGCATTGGCAAAAGGCCCAGAGCTGTTCTTCAACCTCGCCAACCAGGGGCTAAGCGAAGGCGACTATGTG
CGTCGTTTCCGCTACGCCGAAACAGTCAGCACCGCAGAAGTGGCACTCAAAGACTATAGCTTCAAAACCC
CCGCCTACAGCCTGCTGCACAGCAAGATAAGTGGCAAACTGGACCATCAGCGCGAAAGCTACCAGCACTA
TGACTACCCAGGGCGCTTCAAACAGGACCCGAGCGGCAAGGCGTTTACCGGCTACCGACTGGACGCGTTA
CGCGCGAATGCCATGGCGGGTTCAGGCGAATCCAATGCCGCGATGCTGATGCCAGGCAACAGCTTTACCC
TCACCGAACACCCCAACCCCGTGCTCAATACCGGCTGGCAGTTGGTGGCCATTATCCACAGCGGGCAACA
GCCACAAGCGCTGGAAGAAGAAAGCGGCGGCGAACCGACCACCTACAGCAACAGCTTTGAGGTTATCAGT
GCCAAAAGCACCTGGCGTGCGGATTTGCCGTACAAACCGATGGTAGACGGCCCGCAGATCGCGACGGTCG
TCGGCCCCGCAGGGGAAGAAATCTACTGCGACGAATACGGCAGAATCAAACTGCAATTCCCGTGGGACCG
CTACGGCTCCAGTGATGACCAGAGTTCGTGCTGGGTGCGGGTGAGTCAGGGTTGGGCAGGCGGCCAGTAC
GGCTTGATTGCCATTCCACGCATCGGCCATGAAGTGATTGTCAGCTTCCTCGAAGGCGACCCAGACCAGC
CAATTGTCACTGGCAGGACGTTCCATGCCACCAATCCGTCGCCGTACCCGCTGCCCGCCAATAAGACACG
CACCTCGCTGCGTACCTCAACGCACAAAGGGGCCGGGTTCAACGAATTGCGCTTTGAAGATCAGGCCGGT
CAGGAGGAGGTGTTTATTCATGCCCAGAAGGACATGAACACCGTTGTGTTGAATAACCGCACAACCAGTG
TGGCAGCTGACCATACCGAAAGCGTCGGCGGAAATCAGGCAATGTCGGTGGTGAAAGACCAATCTACCGA
GATTCAAGGGCATCAGAATATCGCCGTCACCAAAAACCGCAGCACCACCGTGGATGACAACGACTCCCTG
CAGGTGAAAAACAACATCGCCATTCAATCACAGGAGGGCGACATCCTAATTGCCACCAAAGGCGGTTTTA
TTGGTATCAGCGCCGATGGCGTCATCAACATCAAGGGCAGCCACATTGTGGTAAATGGCCAGCAAATCGA
CCTGAACTGA