SecReT6
Effector Protein ID: 50123198
SecReT6 ID40
T6SS typeA1
Gene symbol-
Locus tagECA4278
StrainPectobacterium atrosepticum SCRI1043
Repliconchromosome [GenBank: NC_004547] [Browse all T6SS(s) in this replicon]
Location [Strand]4792990..4797273 [+]
ProductRhs-family protein
Effector typeProtein
Homologous effectorDda3937_02773
DescriptionRhsB
UniProt IDQ6CZ75
KEGG IDeca:ECA4278
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 6.10E-52, Aligned region: 486..511
RHS_repeat [PF05593], Evalue: 6.10E-52, Aligned region: 559..584
RHS_repeat [PF05593], Evalue: 6.10E-52, Aligned region: 594..627
RHS_repeat [PF05593], Evalue: 6.10E-52, Aligned region: 612..646
RHS_repeat [PF05593], Evalue: 6.10E-52, Aligned region: 654..671
RHS_repeat [PF05593], Evalue: 6.10E-52, Aligned region: 676..713
RHS_repeat [PF05593], Evalue: 6.10E-52, Aligned region: 741..778
RHS_repeat [PF05593], Evalue: 6.10E-52, Aligned region: 766..799
RHS_repeat [PF05593], Evalue: 6.10E-52, Aligned region: 818..842
RHS_repeat [PF05593], Evalue: 6.10E-52, Aligned region: 847..880
RHS_repeat [PF05593], Evalue: 6.10E-52, Aligned region: 867..899
RHS_repeat [PF05593], Evalue: 6.10E-52, Aligned region: 887..908
RHS_repeat [PF05593], Evalue: 6.10E-52, Aligned region: 935..962
RHS_repeat [PF05593], Evalue: 6.10E-52, Aligned region: 976..986
RHS_repeat [PF05593], Evalue: 6.10E-52, Aligned region: 1006..1043
RHS_repeat [PF05593], Evalue: 6.10E-52, Aligned region: 1078..1089
RHS_repeat [PF05593], Evalue: 6.10E-52, Aligned region: 1107..1136
PAAR_motif [PF05488], Evalue: 1.80E-18, Aligned region: 113..178
DUF4150 [PF13665], Evalue: 0.00032, Aligned region: 117..134
DUF4150 [PF13665], Evalue: 0.00032, Aligned region: 139..172
RHS [PF03527], Evalue: 0.0019, Aligned region: 568..581
RHS [PF03527], Evalue: 0.0019, Aligned region: 632..646
RHS [PF03527], Evalue: 0.0019, Aligned region: 1200..1218
DUF4595 [PF15283], Evalue: 0.0023, Aligned region: 470..501
DUF4595 [PF15283], Evalue: 0.0023, Aligned region: 589..633
DUF4595 [PF15283], Evalue: 0.0023, Aligned region: 774..820
DUF4595 [PF15283], Evalue: 0.0023, Aligned region: 865..948
DUF4595 [PF15283], Evalue: 0.0023, Aligned region: 1075..1086
DUF4595 [PF15283], Evalue: 0.0023, Aligned region: 1072..1136
Protein Sequence: 1427 a.a.     [Download]
>gi|50123198|ref|YP_052365.1| unnamed protein product [Pectobacterium atrosepticum SCRI1043]
MRDEILARIARVGAMHAGNRPTLPPDLPAPGSGSPPTSPDKPIKHSSFLGALLGAVAGALVAAAVAAVAV
ALVGVTGGLAIALVGGLAVLGAGSLISAVSGRVSAMVDSASPPAGAVADGSPNVSVEGNPVSRAEVDAVA
CTKHSGPQLIAQGSETVFVNGHPAARIGDKTVCGATIKEGASTVFFGSGQATVLEIQDEFSGWQKALLIA
VEFLVPPTRGLFRGLGKLFFRGPKAVMKGLGAGALWAGKRFKQKTRCATRAFKANKGRARVTQAAKAFKK
DPVYIASGEVIENRTDIELGQTLPLVFERTYRTASSHVGLLGHGWQDSWSEVATVSRDDGDTHVVITLAQ
GYNIDFTFGVGTTVVYCAEYPEFKLVRRHNGFHLWHRDSQTWRAFTVRQDDQLLLSAITDNHFNRIDFIR
DPKGYLRKVQHSDGIELLLVWQGEFLRQVQRIDGGQKTVLAEYRQDEQGRLIEADAAHAYHLFYEYDNHN
RLARWHDNDQTWAQYEYDHQGCCIYTTCADGYLTANFEYLADRVVMTDGLGQRHEYGFNDLYLMTWEKSP
LGHITRFEYDDVGNLLREISPAGRMVEFAYLGDSGLVSTFTDGSGHQWHYDYDDSDRLTSITDPLGRNWV
WQYDTKGNPQSLTGPDNSEVHFAWNRYGLLTEVSDQGGQVQASLFYDHRQRLLSATDAESRTQQLRYDQQ
DRLTTWTRPDGSTYRLGYRRASWKLPEQLLRPDDKQEQRQYDKHNNLLNYTDGNGAVWRQTYGPFDLLTS
RTDAEGRTWRYEYDKESQQLVAVIAPDGNRWQWWLDADARVIREQDMAGTETRYGYDEDGHCISIHNGEG
ETRHFLYDGRGLLIKETAPDDTLHYRYDGAGRLTEVTSATSYIQLSYDVRDRVVQERNSGTEIRRHYQAE
SDAVTRSLYWEGEESSAALTSTFRYSATGELRQVQLPDDAELTLAHDAAGREAARNSNGGFMQQREYDAM
GWLTREMSGQQRDGRLQAEQSREHLYDGAGNLTGTRHNREAEGYRLDASGRVLTVLSGGTGRTVNTEEEY
RYTRTGLPQDATRLTEWQASRLIQRDDTHYQYDKAGRLIRKQVVQPGYRPQVWHYRWDSRNQLRVVDTPT
GERWFYRYDPFGRRTGKRCDQKAEDIRYLWDGDQIAEVRHYRENQLISRRHWVHNGWELLVQQRQNTDGN
WETDFVTSSHNGEPQAIFNQAGELRWQAPRTNLWGHRTTDNTESLDPGLAFAGQYRDEESGLCYNRFRYY
DPSGGCYISPDPIGIRGGLNLYAYVKNPVNWIDPKGLAGCNIVHRAVTPEQAASIRAGNGISRPTPYHRT
TPTQHVAGAPHSRDPWISTTRSQSTAEYFATHGGTQAANPIVNIDLSKIPSDKILDVSNAQKAAEHLQTP
FTRNVAAAHQEVLIFGEIPSEAIIGFL
-
Nucleotide Sequence: 4284 bp     [Download]
>gi|50118965|ref|NC_004547.2|:4792990-4797273 Pectobacterium atrosepticum SCRI1043 chromosome, complete genome
ATGCGTGATGAAATTCTGGCTCGTATTGCGCGGGTGGGTGCGATGCACGCCGGCAACCGCCCCACGCTGC
CGCCCGATTTACCCGCACCCGGCAGTGGTTCTCCCCCCACTTCACCGGACAAGCCCATCAAACACAGCAG
CTTTCTGGGGGCGTTGCTCGGTGCCGTTGCCGGGGCCCTAGTGGCGGCAGCAGTTGCCGCGGTCGCGGTC
GCGTTGGTCGGGGTGACGGGCGGGCTGGCGATTGCACTGGTAGGCGGATTGGCGGTACTGGGGGCGGGTA
GTCTGATATCTGCGGTAAGTGGCCGGGTATCCGCCATGGTAGACAGCGCCTCGCCGCCCGCCGGAGCGGT
GGCTGACGGTTCACCTAACGTGTCTGTTGAAGGCAACCCTGTATCCCGGGCGGAAGTCGATGCAGTGGCG
TGTACCAAACATAGCGGCCCGCAACTCATTGCACAGGGCAGCGAAACCGTCTTCGTTAACGGTCATCCGG
CCGCGCGGATAGGCGATAAAACCGTGTGTGGTGCTACCATCAAGGAAGGAGCATCTACCGTATTCTTTGG
CTCCGGACAGGCTACGGTACTGGAGATACAAGATGAGTTCAGCGGTTGGCAGAAAGCGCTGCTGATTGCG
GTGGAATTTCTTGTGCCACCGACGCGTGGGTTATTTCGCGGGCTGGGGAAATTATTCTTTCGCGGCCCTA
AAGCGGTCATGAAAGGGCTGGGTGCCGGAGCTCTCTGGGCGGGTAAACGCTTTAAGCAAAAGACACGCTG
TGCCACCCGCGCATTTAAGGCGAACAAAGGCCGGGCGCGGGTGACCCAAGCGGCCAAAGCCTTCAAGAAA
GACCCAGTGTATATCGCCAGCGGCGAGGTGATTGAAAACCGCACTGATATCGAACTGGGGCAGACTCTTC
CACTGGTGTTCGAACGCACCTACCGTACCGCCTCTTCACATGTCGGATTATTAGGCCATGGCTGGCAGGA
TAGCTGGAGCGAAGTCGCTACCGTCAGCCGTGATGACGGCGACACCCATGTAGTCATTACACTGGCACAG
GGCTACAACATCGATTTCACCTTCGGGGTGGGCACTACGGTGGTGTACTGCGCCGAATACCCGGAGTTCA
AACTAGTTAGGCGGCATAACGGCTTTCACCTGTGGCACCGTGACAGCCAGACCTGGCGTGCGTTTACCGT
CAGGCAGGATGACCAGCTATTGTTGTCGGCCATCACTGACAACCATTTCAACCGAATCGATTTTATCCGC
GACCCCAAAGGCTACCTGCGCAAGGTGCAGCACAGCGACGGCATCGAGCTGCTGCTGGTATGGCAAGGGG
AATTTCTCCGCCAGGTGCAACGTATCGACGGCGGGCAGAAAACCGTGCTGGCCGAATACCGGCAGGATGA
ACAAGGGAGACTGATCGAGGCCGATGCGGCGCATGCCTATCACCTGTTCTACGAGTACGATAACCACAAC
CGCTTGGCGCGCTGGCACGACAACGACCAGACCTGGGCACAGTATGAATATGACCATCAGGGGTGCTGCA
TTTACACCACCTGCGCCGACGGCTACCTGACCGCCAACTTCGAGTATCTGGCAGACCGCGTGGTGATGAC
AGACGGGCTGGGACAACGCCATGAATATGGCTTTAATGACCTGTACCTGATGACATGGGAGAAATCCCCG
CTCGGCCATATCACCCGCTTTGAGTATGACGATGTCGGTAATCTGCTACGGGAAATCTCCCCTGCGGGCC
GGATGGTGGAATTTGCCTATCTGGGCGACAGCGGGCTGGTCAGTACCTTCACCGATGGCAGTGGCCATCA
ATGGCATTACGACTATGACGACAGCGATCGCCTCACCAGTATCACCGACCCTCTCGGGCGCAACTGGGTC
TGGCAGTACGACACGAAGGGCAATCCGCAAAGCCTGACCGGGCCGGACAACAGCGAAGTGCATTTTGCGT
GGAACCGCTACGGCCTGCTGACCGAAGTCAGTGACCAAGGTGGACAGGTGCAGGCCAGTCTGTTTTACGA
CCATCGACAGCGCCTGCTCAGTGCCACGGATGCGGAGTCCCGCACTCAACAACTACGCTACGACCAACAG
GACAGACTGACCACCTGGACACGCCCGGACGGTTCCACCTATCGCTTGGGTTATCGCCGTGCCAGTTGGA
AACTGCCGGAACAACTGCTACGCCCAGACGACAAGCAAGAACAGCGTCAATACGACAAACACAACAACCT
ACTGAATTACACTGATGGCAACGGCGCGGTTTGGCGGCAAACCTATGGCCCATTCGATCTTCTGACGTCC
CGTACCGATGCGGAAGGCCGCACCTGGCGTTACGAGTACGACAAAGAGAGCCAACAACTCGTCGCTGTTA
TCGCCCCAGATGGGAACCGCTGGCAATGGTGGTTGGATGCCGATGCACGGGTTATCCGCGAGCAGGATAT
GGCTGGCACCGAAACTCGCTACGGCTATGACGAGGATGGCCACTGCATTAGCATCCACAACGGCGAAGGC
GAAACCCGCCACTTCCTGTACGACGGACGCGGGCTACTCATCAAAGAAACCGCACCGGACGATACGCTGC
ACTACCGCTACGATGGGGCAGGCCGACTTACTGAAGTGACGTCTGCGACCAGCTATATCCAGTTGTCGTA
TGACGTACGAGACCGAGTGGTGCAGGAACGGAACAGCGGAACAGAAATCCGACGCCACTATCAGGCAGAG
TCTGACGCCGTTACCCGCAGCTTGTACTGGGAAGGCGAAGAGAGCAGCGCGGCACTCACCAGCACCTTCC
GCTATAGTGCCACGGGTGAACTGCGGCAGGTGCAGTTGCCGGATGACGCAGAGCTAACGTTGGCTCACGA
CGCCGCAGGACGAGAAGCCGCCCGAAATAGCAACGGCGGCTTTATGCAGCAGCGCGAATACGACGCCATG
GGCTGGCTGACGCGCGAGATGAGTGGGCAGCAGCGGGATGGTCGTTTACAGGCCGAACAGAGCCGTGAAC
ATTTGTATGATGGCGCAGGCAACCTAACGGGCACCCGGCACAACCGCGAGGCCGAAGGCTACCGGTTGGA
TGCCAGCGGACGAGTGCTAACCGTCCTGAGCGGCGGCACAGGCCGTACCGTCAATACCGAAGAAGAATAC
CGCTACACCCGCACCGGCCTGCCGCAGGACGCCACAAGATTGACCGAGTGGCAAGCGAGCAGGCTTATTC
AGCGTGACGATACCCACTATCAGTACGACAAAGCCGGACGGCTGATACGCAAACAGGTGGTACAGCCAGG
CTACCGGCCGCAGGTTTGGCACTACCGCTGGGACAGTCGTAACCAGCTCAGAGTGGTGGATACGCCAACG
GGTGAGCGCTGGTTCTACCGTTACGACCCATTCGGGCGACGCACCGGCAAACGCTGTGACCAGAAAGCAG
AAGACATCCGTTACCTCTGGGACGGCGACCAGATAGCTGAAGTGCGGCATTACCGCGAAAACCAGCTCAT
CAGCCGCCGCCACTGGGTACACAATGGCTGGGAGTTGCTGGTGCAACAGCGCCAGAATACCGACGGGAAT
TGGGAGACGGATTTTGTCACCAGCAGCCATAACGGCGAGCCGCAGGCTATCTTTAATCAGGCTGGTGAGC
TTCGCTGGCAGGCGCCGCGCACGAACTTATGGGGGCACCGGACTACAGATAATACTGAAAGTCTCGATCC
GGGGCTGGCATTTGCTGGGCAATACCGTGACGAAGAAAGTGGCTTATGCTATAACCGATTTCGGTATTAT
GATCCAAGCGGTGGTTGCTATATCTCACCTGACCCGATAGGGATAAGAGGTGGTCTTAACCTTTATGCGT
ATGTTAAAAACCCTGTAAATTGGATCGATCCGAAAGGGTTAGCTGGATGTAATATAGTCCATAGGGCGGT
GACTCCTGAACAAGCAGCAAGTATCCGAGCAGGCAATGGAATATCAAGGCCGACTCCATATCATAGAACG
ACACCGACTCAGCATGTAGCAGGAGCACCGCACTCGCGTGATCCGTGGATATCAACAACTAGAAGTCAAT
CAACAGCAGAATACTTCGCCACTCATGGTGGAACCCAAGCAGCAAATCCAATTGTTAATATAGATCTGTC
TAAAATTCCGAGCGATAAGATTTTAGATGTATCAAACGCTCAAAAGGCTGCGGAACATTTGCAGACTCCA
TTCACCCGAAATGTAGCGGCAGCCCACCAAGAAGTATTAATCTTTGGAGAAATACCATCGGAAGCGATAA
TTGGATTTTTATAG