SecReT6
Effector Protein ID: 512615811
hcp
SecReT6 ID808
T6SS typeA2
Gene symbolhcp
Locus tagPCA10_01580
StrainPseudomonas resinovorans NBRC 106553
Repliconchromosome [GenBank: NC_021499] [Browse all T6SS(s) in this replicon]
Location [Strand]175013..175504 [+]
Productputative type VI secretion system effector Hcp
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDS6AEF5
KEGG IDpre:PCA10_01580
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.30E-37, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|512615811|ref|YP_008100495.1| putative type VI secretion system effector Hcp [Pseudomonas resinovorans NBRC 106553]
MAIPVYLWLQDDGGADIKGSVDVQKREGSIEVVAQDHSLYIPTDNNTGKLTGTRVHTPFLFTKEIDASSP
YLYKAVTTGQTLKSAEFKWYRIDDAGQEVEYFITKLENVKVVKVAPKMHDVKDPSKEKHNHLEQVELRYE
KITWTYKDGNIIHSDSWNERQSA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|512615653|ref|NC_021499.1|:175013-175504 Pseudomonas resinovorans NBRC 106553 DNA, complete geonome
ATGGCTATTCCCGTATACCTCTGGCTGCAGGACGACGGCGGCGCGGACATCAAGGGTTCGGTGGACGTGC
AGAAACGCGAGGGAAGCATCGAGGTAGTCGCGCAGGATCACAGCCTGTACATCCCCACCGACAACAACAC
CGGCAAGCTGACCGGCACCCGGGTCCACACCCCCTTCCTCTTCACCAAGGAAATCGATGCCTCCAGCCCC
TACCTGTACAAGGCGGTGACCACCGGCCAAACCCTCAAGAGCGCCGAGTTCAAGTGGTATCGCATCGACG
ACGCCGGCCAGGAAGTCGAGTACTTCATCACCAAGCTGGAGAACGTCAAGGTGGTGAAAGTCGCGCCCAA
GATGCACGACGTCAAGGACCCGTCCAAGGAGAAGCACAACCACCTGGAACAGGTCGAGTTGCGCTACGAG
AAGATCACCTGGACCTACAAGGACGGCAACATCATCCACTCCGATTCCTGGAACGAGCGCCAGAGCGCCT
GA