SecReT6
Effector Protein ID: 514409252
-
SecReT6 ID812
T6SS typeA3
Gene symbol-
Locus tagM062_09645
StrainPseudomonas aeruginosa RP73
Repliconchromosome [GenBank: NC_021577] [Browse all T6SS(s) in this replicon]
Location [Strand]2036013..2036477 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA1844
DescriptionTse1
UniProt IDR9ZBS3
KEGG IDprp:M062_09645
PDB IDNA
Domain hit(s) vs Pfam CHAP [PF05257], Evalue: 0.00018, Aligned region: 29..97
CHAP [PF05257], Evalue: 0.00018, Aligned region: 104..128
NLPC_P60 [PF00877], Evalue: 0.00027, Aligned region: 23..104
NLPC_P60 [PF00877], Evalue: 0.00027, Aligned region: 134..153
Protein Sequence: 154 a.a.     [Download]
>gi|514409252|ref|YP_008132366.1| hypothetical protein M062_09645 [Pseudomonas aeruginosa RP73]
MDSLDQCIVNACKNSWDKSYLAGTPNKDNCSGFVQSVAAELGVPMPRGNANAMVDGLEQSWTKLASGAEA
AQKAAQGFLVIAGLKGRTYGHVAVVISGPLYLQKYPMCWCGSIAGAVGQSQGLKSVGQVWNRTDRDRLNY
YVYSLASCSLPRAS
-
Nucleotide Sequence: 465 bp     [Download]
>gi|514407635|ref|NC_021577.1|:c2036477-2036013 Pseudomonas aeruginosa RP73, complete genome
ATGGACAGTCTCGATCAATGCATCGTCAACGCCTGCAAGAACAGCTGGGACAAGAGCTACCTGGCCGGCA
CCCCGAACAAGGACAACTGTTCCGGCTTCGTCCAGTCGGTGGCCGCCGAGCTGGGCGTACCGATGCCCCG
CGGCAACGCCAACGCCATGGTCGACGGCCTGGAGCAGAGCTGGACCAAGCTCGCCTCCGGCGCCGAGGCC
GCGCAGAAGGCGGCCCAGGGCTTCCTGGTGATCGCCGGCCTGAAGGGCCGCACCTACGGGCACGTCGCGG
TGGTCATCAGCGGTCCGCTGTATCTGCAGAAGTACCCGATGTGCTGGTGCGGCAGCATCGCCGGCGCGGT
CGGCCAGAGCCAGGGCCTGAAGTCGGTCGGCCAGGTGTGGAATCGCACCGACCGCGACCGCCTCAACTAC
TACGTCTACTCCCTGGCCAGTTGCAGCCTGCCCAGGGCCAGTTGA