SecReT6
Effector Protein ID: 514410057
-
SecReT6 ID812
T6SS typeA3
Gene symbol-
Locus tagM062_14770
StrainPseudomonas aeruginosa RP73
Repliconchromosome [GenBank: NC_021577] [Browse all T6SS(s) in this replicon]
Location [Strand]3202263..3202850 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA2774
DescriptionTse4
UniProt IDR9ZE84
KEGG IDprp:M062_14770
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 195 a.a.     [Download]
>gi|514410057|ref|YP_008133382.1| hypothetical protein M062_14770 [Pseudomonas aeruginosa RP73]
MSQLPIPLPLNESRWRYVTASGGGMTVAFLAGSGGSITLLSPEGENVSFRYGGVGGGIGLGMRLPRFGKV
NLNVKGKSVGGAGALEALPSTGTVLVADGLVGRDLSRGDFTGPCMYVELGAGVIAGGSGTAILFGLDPKL
LAAVALASASPLTAALGASMSRQLLQSSRGALLMAGVNVGAQFGGGAAAYLGALF
-
Nucleotide Sequence: 588 bp     [Download]
>gi|514407635|ref|NC_021577.1|:c3202850-3202263 Pseudomonas aeruginosa RP73, complete genome
ATGTCGCAACTTCCCATTCCCTTGCCCCTCAACGAGAGTCGCTGGCGCTACGTGACGGCCAGTGGCGGAG
GCATGACCGTGGCCTTCCTGGCGGGTAGCGGCGGCTCCATCACGTTGCTCTCGCCGGAGGGTGAGAACGT
GTCCTTCCGCTATGGCGGGGTGGGCGGCGGGATCGGACTGGGCATGCGCCTGCCGCGCTTCGGCAAGGTC
AACCTCAATGTCAAGGGCAAGAGCGTTGGCGGGGCCGGTGCGCTGGAGGCGTTGCCGAGCACCGGAACCG
TCTTGGTCGCGGACGGCCTGGTGGGGCGCGACCTGTCCCGCGGCGACTTCACCGGGCCCTGCATGTACGT
CGAACTCGGCGCGGGAGTCATCGCCGGCGGTTCGGGCACGGCGATTCTCTTCGGCCTCGATCCCAAGCTG
CTGGCGGCGGTGGCGCTGGCGAGCGCCTCGCCATTGACCGCCGCGCTGGGCGCCAGCATGTCGCGGCAAT
TACTGCAATCGTCCCGTGGCGCCCTGTTGATGGCCGGGGTCAACGTCGGTGCACAGTTCGGCGGCGGCGC
GGCGGCTTACCTGGGGGCGTTGTTCTGA