SecReT6
Effector Protein ID: 514410704
-
SecReT6 ID812
T6SS typeA3
Gene symbol-
Locus tagM062_18580
StrainPseudomonas aeruginosa RP73
Repliconchromosome [GenBank: NC_021577] [Browse all T6SS(s) in this replicon]
Location [Strand]3978709..3979935 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA3484
DescriptionTse3
UniProt IDR9ZJQ2
KEGG IDprp:M062_18580
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 408 a.a.     [Download]
>gi|514410704|ref|YP_008134125.1| hypothetical protein M062_18580 [Pseudomonas aeruginosa RP73]
MTATSDLIESLISYSWDDWQVTRQEARRVIAAIRNDNVPDATIAALDKSGSLIKLFQRVGPPELARSLIA
SIAGRTTMQRYQARNALIRSLINNPLGTQTDNWIYFPTITFFDICADLADAAGRLGFAAAGATGVASQAI
QGPFSGVGATGVNPTDLPSIAFGDQLKLLNKDPATVTKYSNPLGDLGAYLSQLSPQDKLNQAQTLVGQPI
STLFPDAYPGNPPSRAKVMSAAARKYDLTPQLIGAIILAEQRDQTRDEDAKDYQAAVSIKSANTSIGLGQ
VVVSTAIKYELFTDLLGQPVRRGLSRKAVATLLASDEFNIFATARYIRYVANLASQQDLRKLPKTRGAFP
SIDLRAYAGNPRNWPRDNVRALASEYTSRPWDDNLSPGWPMFVDDAYATFLDPGMRFP
-
Nucleotide Sequence: 1227 bp     [Download]
>gi|514407635|ref|NC_021577.1|:3978709-3979935 Pseudomonas aeruginosa RP73, complete genome
ATGACCGCCACCAGCGACCTGATCGAGTCACTGATTTCCTATAGCTGGGACGACTGGCAGGTGACCCGCC
AGGAAGCCCGCCGGGTGATCGCCGCGATCCGCAACGACAACGTGCCCGATGCGACCATCGCCGCACTCGA
CAAGAGCGGCTCGCTGATCAAGCTGTTCCAGCGGGTGGGCCCGCCGGAACTGGCGCGCTCGCTGATCGCC
AGCATCGCCGGGCGCACCACCATGCAGCGCTACCAGGCACGCAATGCCTTGATCCGCAGCCTGATCAACA
ATCCCCTGGGCACCCAGACCGACAACTGGATCTACTTCCCCACCATCACTTTCTTCGACATCTGCGCCGA
CCTCGCCGACGCCGCCGGTCGCCTGGGCTTCGCCGCGGCCGGCGCCACCGGGGTGGCCAGCCAGGCGATC
CAGGGTCCGTTCAGCGGGGTCGGCGCCACCGGCGTCAATCCGACCGACCTGCCGTCCATTGCCTTCGGCG
ACCAGCTCAAGCTGCTCAACAAGGACCCGGCGACCGTCACCAAGTACAGCAACCCGCTCGGCGACCTGGG
CGCCTACCTGAGCCAACTGTCGCCGCAAGACAAGCTGAACCAGGCACAGACGCTGGTCGGCCAGCCGATC
AGCACGCTGTTCCCCGACGCCTATCCGGGCAACCCGCCGTCGCGGGCCAAGGTCATGTCCGCGGCTGCGC
GCAAGTACGACCTGACGCCGCAACTGATCGGCGCGATCATCCTCGCCGAGCAGCGTGACCAGACCCGCGA
CGAAGACGCCAAGGACTATCAGGCGGCAGTCAGCATCAAGAGCGCCAACACCTCCATCGGCCTCGGCCAG
GTGGTGGTCTCCACCGCGATCAAGTACGAGCTGTTCACCGACCTGCTCGGCCAGCCGGTGCGCCGCGGCC
TGTCGCGCAAGGCGGTCGCCACCCTGCTGGCCTCCGACGAATTCAACATCTTCGCCACCGCCCGTTACAT
CCGCTACGTCGCCAACCTGGCGTCGCAACAGGACCTGCGCAAGCTGCCGAAGACCCGCGGCGCATTTCCC
TCCATCGATCTCCGCGCCTACGCCGGCAATCCGCGCAACTGGCCGCGGGACAATGTCCGCGCGCTGGCCT
CGGAATACACCTCGCGGCCCTGGGACGACAACCTGTCGCCGGGCTGGCCGATGTTCGTCGACGATGCCTA
CGCCACCTTCCTCGACCCTGGAATGAGGTTCCCATGA