SecReT6
Effector Protein ID: 514412675
-
SecReT6 ID812
T6SS typeA3
Gene symbol-
Locus tagM062_00480
StrainPseudomonas aeruginosa RP73
Repliconchromosome [GenBank: NC_021577] [Browse all T6SS(s) in this replicon]
Location [Strand]114336..115628 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA0093
DescriptionTse6
UniProt IDR9ZM60
KEGG IDprp:M062_00480
PDB IDNA
Domain hit(s) vs Pfam Toxin_61 [PF15538], Evalue: 3.30E-75, Aligned region: 266..422
PAAR_motif [PF05488], Evalue: 1.10E-14, Aligned region: 4..16
PAAR_motif [PF05488], Evalue: 1.10E-14, Aligned region: 78..153
DUF4150 [PF13665], Evalue: 0.006, Aligned region: 84..104
DUF4150 [PF13665], Evalue: 0.006, Aligned region: 125..146
Protein Sequence: 430 a.a.     [Download]
>gi|514412675|ref|YP_008130562.1| hypothetical protein M062_00480 [Pseudomonas aeruginosa RP73]
MDAQAAARLGDEIAHGFGVAAMVAGAVAGALIGAAVVAATAATGGLAAVILAGSIAAGGLSMFQIVKGLT
TIFELPEPTTGVLIRGSFNVYVNSRNAMRAGDDVSATCSGLPLNHPLWPFPVLIAEGSATVYINGKPAAR
LQSKMVCGAHIKTGSQDTFIGGPTERVAFVLDLEEWLHTGLEALGLAALAGGLLLAAMAGVAALAGFVAI
GGLMMGGMALLGDLGDRLGPGYRDLFQGVAGMALLGFGPKLAGRRPAAVTSETAQRRAYLNNKFGRSGNL
DHDINYRGNRETAAKFFKSKDIDPADAESYMNGLDFNHPVRVETLAPGKNLWQYQSPGAPQGNWYTLSPR
VQPTELGINPMGTNRAANTIEPKVLNSYRTTQKVEVLRSTAAPTDDFWSVKGQSYPAKGGAQQLFSNEKG
SFGLLPREGS
-
Nucleotide Sequence: 1293 bp     [Download]
>gi|514407635|ref|NC_021577.1|:c115628-114336 Pseudomonas aeruginosa RP73, complete genome
ATGGATGCGCAAGCCGCCGCCCGACTGGGCGATGAGATAGCCCACGGTTTCGGTGTCGCCGCGATGGTCG
CCGGAGCCGTGGCCGGAGCCCTGATCGGCGCCGCCGTGGTCGCCGCCACCGCCGCCACCGGCGGCCTGGC
CGCGGTGATCCTGGCCGGCTCGATCGCCGCCGGCGGGCTGTCGATGTTCCAGATCGTCAAGGGCCTGACC
ACCATCTTCGAGCTACCCGAGCCGACCACCGGGGTGCTCATACGCGGCAGCTTCAACGTCTACGTGAACA
GTCGCAACGCGATGCGCGCCGGCGACGACGTCTCCGCCACCTGCAGCGGCCTGCCGCTGAACCATCCGCT
GTGGCCGTTCCCGGTGCTGATCGCCGAAGGCAGCGCCACCGTGTACATCAACGGCAAGCCGGCGGCGCGC
CTGCAGAGCAAGATGGTCTGCGGCGCACACATCAAGACCGGCAGCCAGGACACCTTCATCGGCGGCCCCA
CCGAGCGGGTGGCCTTCGTCCTCGACCTGGAGGAATGGCTGCACACCGGCCTCGAGGCGCTGGGCCTGGC
GGCCCTTGCCGGCGGCCTGCTGCTGGCGGCGATGGCCGGGGTCGCGGCGCTGGCCGGCTTCGTCGCCATC
GGCGGGCTGATGATGGGCGGCATGGCCCTGCTCGGCGACCTCGGCGACCGCCTCGGTCCCGGCTACCGCG
ACCTGTTCCAGGGCGTGGCGGGGATGGCATTGCTGGGCTTCGGGCCGAAACTCGCCGGTCGTCGTCCGGC
AGCGGTGACCTCCGAAACCGCGCAACGACGCGCCTACCTGAACAACAAGTTCGGTCGTTCCGGCAACCTC
GACCACGACATCAACTACCGCGGGAATCGTGAAACCGCCGCCAAGTTCTTCAAGTCGAAGGACATCGATC
CTGCCGATGCCGAGTCGTACATGAACGGCCTGGACTTCAACCATCCGGTCCGTGTGGAAACCCTCGCGCC
CGGCAAGAACCTGTGGCAGTACCAGTCCCCCGGAGCGCCGCAGGGCAACTGGTATACACTCAGCCCGCGC
GTGCAGCCCACGGAGCTGGGAATCAACCCCATGGGCACCAACCGGGCGGCGAACACCATCGAACCCAAGG
TCCTCAACTCCTACAGGACGACCCAGAAGGTCGAGGTCCTGCGCAGCACCGCTGCGCCGACCGATGACTT
CTGGTCGGTAAAGGGACAGTCATATCCCGCCAAAGGCGGCGCGCAACAACTGTTCTCCAACGAGAAAGGC
TCCTTCGGTCTGCTTCCCCGGGAGGGATCATGA