SecReT6
Effector Protein ID: 514412925
-
SecReT6 ID813
T6SS typeA1
Gene symbol-
Locus tagM062_08085
StrainPseudomonas aeruginosa RP73
Repliconchromosome [GenBank: NC_021577] [Browse all T6SS(s) in this replicon]
Location [Strand]1703029..1703547 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPSPTO_5435
DescriptionHcp protein
UniProt IDR9ZQN1
KEGG IDprp:M062_27760, prp:M062_01295, prp:M062_08085
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.60E-41, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|514412925|ref|YP_008132062.1| hypothetical protein M062_08085 [Pseudomonas aeruginosa RP73]
MATPAYMSITGTKQGLITAGAFTEDSVGNTYQEGHEDQVMVQGFNHEVIIPRDPQSGQPTGQRVHKPVVI
TKVFDKASPLLLAALTSGERLTKVEIQWYRTSAAGTQEHYYTTVLEDAIIVDIKDYMHNCQDPGNAHFTH
LEDVHFTYRKITWTHEVSGTSGSDDWRSPVAG
-
Nucleotide Sequence: 519 bp     [Download]
>gi|514407635|ref|NC_021577.1|:c1703547-1703029 Pseudomonas aeruginosa RP73, complete genome
ATGGCAACCCCCGCCTATATGTCCATCACCGGCACCAAGCAGGGCCTGATCACCGCCGGCGCCTTCACCG
AGGATTCGGTCGGCAACACCTACCAGGAAGGCCACGAGGACCAGGTGATGGTCCAGGGCTTCAACCACGA
AGTGATCATCCCGCGCGACCCGCAGTCCGGCCAGCCGACCGGCCAGCGCGTGCACAAGCCGGTGGTCATC
ACCAAGGTCTTCGACAAGGCCTCGCCCCTGCTGCTGGCCGCCCTGACCTCCGGCGAGCGCCTGACCAAGG
TCGAGATCCAGTGGTACCGCACCTCCGCCGCCGGCACCCAGGAGCACTACTACACCACCGTCCTGGAAGA
CGCGATCATCGTCGACATCAAGGACTACATGCACAACTGCCAGGACCCGGGCAACGCCCACTTCACCCAC
CTGGAAGACGTGCACTTCACCTACCGCAAGATCACCTGGACCCACGAAGTCTCTGGCACCTCCGGCTCCG
ACGACTGGCGCTCGCCGGTGGCAGGGTGA