SecReT6
Effector Protein ID: 525711941
-
SecReT6 ID819
T6SS typeA4b
Gene symbol-
Locus tagF504_4476
StrainRalstonia solanacearum FQY_4
Repliconmegaplasmid [GenBank: NC_021745] [Browse all T6SS(s) in this replicon]
Location [Strand]1273086..1273589 [-]
ProductHypothetical Protein
Effector typeProtein
Homologous effectorRSp0745
DescriptionHcp protein
UniProt IDM4V2U4
KEGG IDrse:F504_4476
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.50E-43, Aligned region: 5..140
Protein Sequence: 167 a.a.     [Download]
>gi|525711941|ref|YP_008238205.1| Hypothetical Protein F504_4476 [Ralstonia solanacearum FQY_4]
MKDIYVKFDSPAIKGESQDKDHKEWIEVNSWSQSIIQPRSATASTAGGHTAERCEHRDMVFSKDLDVVSP
LLYQHASGGTTFGEVTIEFFRADGEGNRVKYLEVKLKNAILSEVDSQVAAEGIPTDTFSLRYAAVQWKYT
QQKSAGGQGGNSQGAWSLTKNDKTYSV
-
Nucleotide Sequence: 504 bp     [Download]
>gi|525710956|ref|NC_021745.1|:c1273589-1273086 Ralstonia solanacearum FQY_4 megaplasmid, partial sequence
ATGAAGGATATCTACGTCAAGTTCGACAGCCCGGCCATCAAGGGGGAGTCCCAGGACAAGGATCACAAGG
AGTGGATCGAAGTCAACAGCTGGTCCCAGTCGATCATCCAGCCGCGTTCGGCCACGGCCTCGACCGCGGG
CGGCCATACCGCCGAGCGTTGCGAGCACCGCGACATGGTGTTCTCCAAGGACCTGGACGTGGTCAGCCCG
CTGCTGTACCAGCACGCTTCGGGCGGCACGACCTTCGGTGAAGTGACGATCGAGTTCTTCCGCGCCGACG
GTGAAGGCAACCGCGTGAAGTACCTCGAGGTCAAGCTGAAGAACGCGATCCTGAGCGAAGTGGATTCGCA
GGTGGCTGCCGAGGGCATCCCGACCGATACGTTCAGCCTGCGCTACGCGGCCGTGCAGTGGAAGTACACC
CAGCAGAAGAGCGCCGGTGGCCAGGGCGGCAACTCGCAGGGCGCCTGGAGCCTGACCAAGAACGACAAGA
CCTACTCGGTTTAA