SecReT6
Effector Protein ID: 525816142
-
SecReT6 ID820
T6SS typeA3
Gene symbol-
Locus tagSEEH1578_10465
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. 41578
Repliconchromosome [GenBank: NC_021810] [Browse all T6SS(s) in this replicon]
Location [Strand]2116740..2117141 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorSTY0300
DescriptionTae2_TY
UniProt IDS5H3B0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 133 a.a.     [Download]
>gi|525816142|ref|YP_008246160.1| hypothetical protein SEEH1578_10465 [Salmonella enterica subsp. enterica serovar Heidelberg str. 41578]
MPYVYANAKALQDTEKVGNHHQCVELIQHYIRVGQTSTWQQGAAVFGNKNIEVGTVIATFVNGRYPNHNS
GNHAAFFLGQDAGGIWVMDQWKDDIAKPRVSKRYIRKLHNGSVRSDGTYIRMSNNAEAYFIVE
-
Nucleotide Sequence: 402 bp     [Download]
>gi|525814190|ref|NC_021810.1|:2116740-2117141 Salmonella enterica subsp. enterica serovar Heidelberg str. 41578, complete genome
ATGCCATATGTTTATGCTAATGCAAAGGCTTTACAGGATACAGAAAAGGTAGGAAACCACCATCAGTGTG
TTGAACTTATTCAACACTATATACGAGTAGGACAAACGAGTACATGGCAGCAAGGGGCCGCAGTATTTGG
AAACAAAAACATTGAAGTCGGGACAGTTATTGCTACTTTTGTGAATGGGCGATATCCGAACCACAATAGT
GGCAACCATGCTGCATTTTTTCTGGGGCAAGATGCTGGCGGGATATGGGTGATGGATCAATGGAAAGATG
ATATCGCAAAACCCCGTGTGTCCAAACGTTATATAAGAAAGTTGCATAATGGAAGTGTTCGTAGTGACGG
GACTTATATAAGGATGAGTAATAATGCAGAAGCCTATTTTATTGTTGAATAG