SecReT6
Effector Protein ID: 525816144
-
SecReT6 ID820
T6SS typeA3
Gene symbol-
Locus tagSEEH1578_10475
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. 41578
Repliconchromosome [GenBank: NC_021810] [Browse all T6SS(s) in this replicon]
Location [Strand]2117775..2118260 [+]
ProductProtein hcp1
Effector typeProtein
Homologous effectorEvpC
DescriptionHcp protein
UniProt IDS5GT07
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-41, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|525816144|ref|YP_008246162.1| Protein hcp1 [Salmonella enterica subsp. enterica serovar Heidelberg str. 41578]
MAYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSGLGSGKVSVTNLDFDHYIDRASPNLF
KYCASGKHIPQAILVMRKAGGNPLEYLKYTFTDLIVAVVSPSGSHDGEIASRETVELSFSTVKQEYVVQN
QQGGSGGTITAGYDFKANKEI
-
Nucleotide Sequence: 486 bp     [Download]
>gi|525814190|ref|NC_021810.1|:2117775-2118260 Salmonella enterica subsp. enterica serovar Heidelberg str. 41578, complete genome
ATGGCTTATGACATTTTTCTGAAAATTGACGGCATCGACGGTGAGTCGATGGATGACAAACACAAAAATG
AAATTGAAGTACTGAGCTGGCGCTGGAATATCCATCAGGAATCCACCATGCACGCCGGTAGCGGCCTCGG
CTCCGGTAAGGTCTCCGTCACCAACCTGGATTTTGATCACTATATCGACCGCGCCAGCCCGAACCTGTTC
AAATACTGCGCCTCCGGCAAGCACATTCCGCAGGCCATTCTGGTTATGCGTAAGGCTGGCGGCAATCCGC
TGGAGTACCTCAAGTATACCTTCACCGACCTGATTGTCGCCGTGGTTTCCCCGAGCGGCAGCCACGATGG
TGAAATCGCCTCCCGTGAAACGGTAGAGCTTTCTTTCAGCACTGTGAAACAGGAATACGTGGTGCAGAAC
CAGCAGGGCGGCAGCGGCGGCACTATCACCGCAGGTTACGATTTCAAGGCGAACAAAGAAATTTAA