SecReT6
Effector Protein ID: 525816145
-
SecReT6 ID820
T6SS typeA3
Gene symbol-
Locus tagSEEH1578_10480
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. 41578
Repliconchromosome [GenBank: NC_021810] [Browse all T6SS(s) in this replicon]
Location [Strand]2118563..2119048 [+]
ProductType VI secretion system-associated protein
Effector typeProtein
Homologous effectorSTM0277
DescriptionTae4_TM
UniProt IDS5H147
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF4285 [PF14113], Evalue: 4.00E-28, Aligned region: 40..141
Protein Sequence: 161 a.a.     [Download]
>gi|525816145|ref|YP_008246163.1| Type VI secretion system-associated protein [Salmonella enterica subsp. enterica serovar Heidelberg str. 41578]
MNRPSFNEAWLAFRKVNHSVADVGSIIGGNVGKNITGSYFQNACPIRMSYVLNATGFPIARNSPYAKVSG
ADNKFYIYRVNDMIDYLTHTMGKPDLIVNNPKQSDFIGKKGIIVVKGHGWSNARGHVTLWNGSICSDQCH
LLNDPDNGPFVPEVGTLWILP
-
Nucleotide Sequence: 486 bp     [Download]
>gi|525814190|ref|NC_021810.1|:2118563-2119048 Salmonella enterica subsp. enterica serovar Heidelberg str. 41578, complete genome
ATGAACAGACCTTCATTCAATGAAGCGTGGTTAGCTTTTAGGAAGGTGAATCATTCCGTCGCTGATGTGG
GTAGCATTATTGGTGGAAACGTTGGGAAAAATATAACTGGTAGTTATTTTCAAAATGCCTGCCCTATTCG
AATGAGCTATGTTTTGAATGCGACAGGATTCCCAATAGCCCGTAACTCTCCGTATGCAAAGGTTAGTGGT
GCCGATAATAAATTCTATATTTATCGCGTGAATGATATGATTGATTATCTTACTCATACTATGGGCAAGC
CTGATCTTATTGTTAATAATCCGAAACAGAGTGACTTTATAGGGAAGAAAGGAATTATCGTAGTAAAAGG
GCATGGCTGGAGCAATGCCAGAGGACACGTTACATTATGGAATGGCAGTATCTGTTCAGATCAGTGCCAC
TTATTAAATGACCCAGATAATGGACCATTTGTTCCTGAAGTTGGGACTCTGTGGATACTGCCGTGA