SecReT6
Effector Protein ID: 525818263
-
SecReT6 ID820
T6SS typeA3
Gene symbol-
Locus tagSEEH1578_21150
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. 41578
Repliconchromosome [GenBank: NC_021810] [Browse all T6SS(s) in this replicon]
Location [Strand]4280206..4280574 [+]
ProductNlpC/P60 enzyme
Effector typeProtein
Homologous effectorSTY2606
DescriptionTae3_TY
UniProt IDS5H073
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NLPC_P60 [PF00877], Evalue: 9.10E-05, Aligned region: 23..95
CHAP [PF05257], Evalue: 0.0001, Aligned region: 17..88
Protein Sequence: 122 a.a.     [Download]
>gi|525818263|ref|YP_008248281.1| NlpC/P60 enzyme [Salmonella enterica subsp. enterica serovar Heidelberg str. 41578]
MSWDKRVAVNYAKTHAGSHSQGRCAEFTRKAIQAGGITLGHTYHAKDYGPMLRSAGFTAIGTYEMPREGD
VIIIQPYAGGNPSGHMAIYDGTEWYSDFKQRDMWAGPGYRAARPSYTIYRKN
-
Nucleotide Sequence: 369 bp     [Download]
>gi|525814190|ref|NC_021810.1|:4280206-4280574 Salmonella enterica subsp. enterica serovar Heidelberg str. 41578, complete genome
ATGAGTTGGGATAAAAGAGTGGCGGTTAATTATGCCAAAACGCATGCAGGTTCTCATTCTCAAGGCCGGT
GTGCGGAATTTACCCGAAAGGCAATTCAGGCGGGCGGTATCACGCTGGGGCATACATATCATGCGAAAGA
TTATGGCCCAATGTTAAGAAGCGCCGGATTCACCGCTATTGGTACCTATGAAATGCCGCGCGAGGGTGAC
GTCATTATTATTCAACCTTACGCTGGCGGAAACCCGAGCGGTCACATGGCGATATACGATGGCACAGAGT
GGTATTCAGATTTTAAACAACGCGATATGTGGGCCGGCCCGGGCTACCGGGCAGCCAGGCCCTCATATAC
CATCTACAGGAAGAATTAA