SecReT6
Effector Protein ID: 525827695
-
SecReT6 ID821
T6SS typeA3
Gene symbol-
Locus tagCFSAN002069_07755
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069
Repliconchromosome [GenBank: NC_021812] [Browse all T6SS(s) in this replicon]
Location [Strand]803810..804295 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorSTM0277
DescriptionTae4_TM
UniProt IDS5I9B3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF4285 [PF14113], Evalue: 4.00E-28, Aligned region: 40..141
Protein Sequence: 161 a.a.     [Download]
>gi|525827695|ref|YP_008250386.1| hypothetical protein CFSAN002069_07755 [Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069]
MNRPSFNEAWLAFRKVNHSVADVGSIIGGNVGKNITGSYFQNACPIRMSYVLNATGFPIARNSPYAKVSG
ADNKFYIYRVNDMIDYLTHTMGKPDLIVNNPKQSDFIGKKGIIVVKGHGWSNARGHVTLWNGSICSDQCH
LLNDPDNGPFVPEVGTLWILP
-
Nucleotide Sequence: 486 bp     [Download]
>gi|559996969|ref|NC_021812.2|:803810-804295 Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069, complete genome
ATGAACAGACCTTCATTCAATGAAGCGTGGTTAGCTTTTAGGAAGGTGAATCATTCCGTCGCTGATGTGG
GTAGCATTATTGGTGGAAACGTTGGGAAAAATATAACTGGTAGTTATTTTCAAAATGCCTGCCCTATTCG
AATGAGCTATGTTTTGAATGCGACAGGATTCCCAATAGCCCGTAACTCTCCGTATGCAAAGGTTAGTGGT
GCCGATAATAAATTCTATATTTATCGCGTGAATGATATGATTGATTATCTTACTCATACTATGGGCAAGC
CTGATCTTATTGTTAATAATCCGAAACAGAGTGACTTTATAGGGAAGAAAGGAATTATCGTAGTAAAAGG
GCATGGCTGGAGCAATGCCAGAGGACACGTTACATTATGGAATGGCAGTATCTGTTCAGATCAGTGCCAC
TTATTAAATGACCCAGATAATGGACCATTTGTTCCTGAAGTTGGGACTCTGTGGATACTGCCGTGA