SecReT6
Effector Protein ID: 525848286
-
SecReT6 ID825
T6SS typeA5
Gene symbol-
Locus tagM634_23055
StrainVibrio parahaemolyticus O1:Kuk str. FDA_R31
Repliconchromosome II [GenBank: NC_021821] [Browse all T6SS(s) in this replicon]
Location [Strand]1497815..1498294 [-]
Producthemolysin D
Effector typeProtein
Homologous effectorVPA1027
DescriptionHcp protein
UniProt IDS5J041
KEGG IDvpf:M634_23055
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.60E-30, Aligned region: 6..134
Protein Sequence: 159 a.a.     [Download]
>gi|525848286|ref|YP_008268925.1| hemolysin D [Vibrio parahaemolyticus O1:Kuk str. FDA_R31]
MQSNTYLKYADIKGEATAEQYKDLITLLSVDWSVGREISSYTGTAMDREASATRLYDLTITKLQDRSSPD
LFKEATIGKGKPAVFHITKQGEKVEEIMKIELTDAMISNYSVSIQDDRPVETITISYTEMMMTVTPTDDK
NNTSAPLVYGYSGVKGQQM
-
Nucleotide Sequence: 480 bp     [Download]
>gi|525847173|ref|NC_021821.1|:c1498294-1497815 Vibrio parahaemolyticus O1:Kuk str. FDA_R31 chromosome II, complete sequence
ATGCAGTCTAATACGTATCTTAAATACGCAGATATTAAAGGTGAAGCGACAGCGGAACAATATAAGGATT
TAATTACACTACTATCTGTAGATTGGAGTGTTGGTCGTGAAATTTCTTCTTACACAGGTACAGCAATGGA
CCGTGAAGCAAGTGCAACACGCCTATATGATTTAACTATCACTAAACTTCAAGATCGTTCGTCTCCTGAT
CTATTCAAGGAAGCAACAATCGGTAAAGGTAAACCTGCAGTATTCCACATCACTAAGCAGGGTGAAAAAG
TTGAAGAAATCATGAAAATCGAACTGACTGATGCGATGATTTCTAACTACTCAGTATCGATTCAAGATGA
TCGCCCAGTAGAAACTATCACAATTTCATACACTGAAATGATGATGACAGTGACACCTACTGATGACAAA
AACAACACTTCTGCTCCGTTGGTTTACGGCTACAGCGGTGTTAAAGGTCAACAAATGTAA