SecReT6
Effector Protein ID: 525856676
-
SecReT6 ID823
T6SS typeA3
Gene symbol-
Locus tagCFSAN002050_07920
StrainSalmonella enterica subsp. enterica Serovar Cubana str. CFSAN002050
Repliconchromosome [GenBank: NC_021818] [Browse all T6SS(s) in this replicon]
Location [Strand]1329236..1329721 [+]
ProductHcp1 family type VI secretion system effector
Effector typeProtein
Homologous effectorEvpC
DescriptionHcp protein
UniProt IDS5HQP2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-41, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|525856676|ref|YP_008259519.1| Hcp1 family type VI secretion system effector [Salmonella enterica subsp. enterica serovar Cubana str. CFSAN002050]
MAYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSGLGSGKVSVTNLDFDHYIDRASPNLF
KYCASGKHIPQAILVMRKAGGNPLEYLKYTFTDLIVAVVSPSGSHDGEIASRETVELSFSTVKQEYVVQN
QQGGSGGTITAGYDFKANKEI
-
Nucleotide Sequence: 486 bp     [Download]
>gi|525855729|ref|NC_021818.1|:1329236-1329721 Salmonella enterica subsp. enterica Serovar Cubana str. CFSAN002050, complete genome
ATGGCTTATGACATTTTTTTAAAAATTGACGGCATTGATGGCGAGTCAATGGATGACAAACACAAAAATG
AAATTGAAGTACTGAGCTGGCGCTGGAATATTCATCAGGAATCCACCATGCACGCCGGTAGCGGCCTCGG
CTCCGGTAAGGTCTCCGTCACCAACCTGGATTTTGATCACTATATCGATCGCGCCAGCCCGAACCTGTTC
AAATACTGCGCCTCCGGCAAGCACATTCCGCAGGCCATTCTGGTTATGCGTAAGGCTGGCGGCAATCCGC
TGGAGTACCTCAAGTATACCTTCACCGACCTGATTGTCGCCGTGGTTTCCCCGAGCGGCAGCCACGATGG
TGAAATCGCCTCCCGTGAAACGGTGGAGCTCTCCTTCAGCACCGTGAAGCAGGAATACGTGGTGCAGAAC
CAGCAGGGCGGCAGCGGCGGCACCATCACCGCAGGCTACGACTTCAAGGCGAACAAAGAAATTTAA