SecReT6
Effector Protein ID: 525858886
-
SecReT6 ID823
T6SS typeA3
Gene symbol-
Locus tagCFSAN002050_22600
StrainSalmonella enterica subsp. enterica Serovar Cubana str. CFSAN002050
Repliconchromosome [GenBank: NC_021818] [Browse all T6SS(s) in this replicon]
Location [Strand]4346566..4347051 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorROD_34191
DescriptionHcp protein
UniProt IDS5HXA0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 8.60E-38, Aligned region: 5..135
Protein Sequence: 161 a.a.     [Download]
>gi|525858886|ref|YP_008262386.1| hypothetical protein CFSAN002050_22600 [Salmonella enterica subsp. enterica serovar Cubana str. CFSAN002050]
MDAIFLKLDNIKGESQVEGFEDQIEIMSYSHNVAMQVNNDVSLTERTSGRAHVGEMSLTKFVDLATPVLN
EYCCSGRLIRTAVLTLCHNDGGKMRSLIVYTLTNVLISQLSVSGGAGGKPVETMSLNFTKIKWQITAEKS
DSAQQESRASVWDLAMDQIGK
-
Nucleotide Sequence: 486 bp     [Download]
>gi|525855729|ref|NC_021818.1|:c4347051-4346566 Salmonella enterica subsp. enterica Serovar Cubana str. CFSAN002050, complete genome
ATGGATGCGATTTTTTTAAAGCTCGACAATATCAAAGGCGAAAGCCAGGTTGAAGGCTTTGAAGATCAGA
TAGAGATCATGTCTTATAGCCACAATGTGGCAATGCAGGTAAATAACGATGTTAGCCTCACGGAGCGGAC
CTCCGGGCGTGCACATGTTGGTGAAATGTCGCTCACCAAATTTGTCGACCTCGCCACGCCTGTGCTCAAT
GAGTACTGCTGTAGCGGGAGGCTAATTAGAACCGCGGTGCTGACGTTGTGCCACAATGACGGCGGCAAAA
TGCGGTCGCTTATCGTTTATACCCTGACAAACGTGCTGATATCACAACTCAGTGTTAGCGGCGGCGCCGG
CGGTAAGCCGGTGGAAACGATGTCGCTGAACTTCACGAAAATCAAATGGCAAATCACTGCCGAGAAATCA
GACAGCGCTCAACAGGAGTCCAGAGCGTCAGTATGGGATCTGGCGATGGACCAGATAGGGAAATGA