SecReT6
Effector Protein ID: 526219211
-
SecReT6 ID824
T6SS typeA3
Gene symbol-
Locus tagSE451236_07400
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. 08-1736
Repliconchromosome [GenBank: NC_021820] [Browse all T6SS(s) in this replicon]
Location [Strand]1606102..1606587 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorSTM0277
DescriptionTae4_TM
UniProt IDS5IJX5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF4285 [PF14113], Evalue: 4.00E-28, Aligned region: 40..141
Protein Sequence: 161 a.a.     [Download]
>gi|526219211|ref|YP_008264529.1| hypothetical protein SE451236_07400 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. 08-1736]
MNRPSFNEAWLAFRKVNHSVADVGSIIGGNVGKNITGGYFQNACPIRMSYVLNATGFPIARNSPYAKVSG
ADNKFYIYRVNDMIDYLTHTMGKPDLIVNNPKQSDFIGKKGIIVVKGHGWSNARGHVTLWNGSICSDQCH
LLNDPDNGPFVPEVGTLWILP
-
Nucleotide Sequence: 486 bp     [Download]
>gi|526218030|ref|NC_021820.1|:1606102-1606587 Salmonella enterica subsp. enterica serovar Typhimurium str. 08-1736, complete genome
ATGAACAGACCTTCATTCAATGAAGCGTGGTTAGCTTTTAGGAAGGTGAATCATTCCGTCGCTGATGTGG
GTAGCATTATTGGTGGAAACGTTGGGAAAAATATAACTGGTGGTTATTTTCAAAATGCCTGCCCTATTCG
AATGAGCTATGTTTTGAATGCGACAGGGTTCCCAATAGCCCGTAACTCTCCGTATGCAAAGGTTAGTGGT
GCCGATAATAAATTCTATATTTATCGCGTGAATGATATGATTGATTATCTTACTCATACTATGGGCAAGC
CTGATCTTATTGTTAATAATCCGAAACAGAGTGACTTTATCGGGAAGAAAGGAATTATCGTAGTAAAAGG
GCATGGCTGGAGCAATGCCAGAGGACACGTTACATTATGGAATGGCAGTATCTGTTCAGATCAGTGCCAC
TTATTAAATGACCCAGATAATGGACCATTTGTTCCTGAAGTTGGGACACTGTGGATACTGCCGTGA