SecReT6
Effector Protein ID: 526457410
-
SecReT6 ID830
T6SS typeA1
Gene symbol-
Locus tagBDL_4824
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome II [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]1675824..1677035 [+]
Productubiquitin carboxyl-terminal hydrolase family protein
Effector typeProtein
Homologous effectorBMAA0729
Descriptionputative deubiquitinase
UniProt IDS5NKR1
KEGG IDbpse:BDL_4824
PDB IDNA
Domain hit(s) vs Pfam Big_5 [PF13205], Evalue: 4.60E-09, Aligned region: 73..73
Big_5 [PF13205], Evalue: 4.60E-09, Aligned region: 109..208
UCH [PF00443], Evalue: 3.10E-07, Aligned region: 215..247
UCH [PF00443], Evalue: 3.10E-07, Aligned region: 347..377
Protein Sequence: 403 a.a.     [Download]
>gi|526457410|ref|YP_008328601.1| ubiquitin carboxyl-terminal hydrolase family protein [Burkholderia pseudomallei MSHR305]
MRSPQRGGAALALAVASLAGCGGGDSGEPAPREFAPPTVQLAYPTQPNSPVAPAPTAHVSSGHTPPATAP
AAMPTASPTATPTASPTATAAASPSAPSTATPNAPPAAPPAVVATRVPPTHAALRRPTIELEFDRAIEPG
SVPHIALRADDGTSVAVGPLSWLSDRRIAFAPRKLLKSNSRYEIMVPAGIRSTTGERSTHPLTSSFDTAP
VTPPRGLPNLDGASCFINTALQLAVHSSALDDILSNEAVPPAVRTLLEDYDAASADALDAQLAAAVAALR
ERLRIPGGEAGPVQEALKEMGMPLHETFDVSDIHSAPAGTKAFILNSSYDYAALPNHDRLVAFSYYTGGH
YLAYVKRDGIWYSVDDARVSEVSEQQLRDLTPLFHHPTNSDVSGAAIEIAIYR
-
Nucleotide Sequence: 1212 bp     [Download]
>gi|526456747|ref|NC_021877.1|:1675824-1677035 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGCGCTCGCCCCAACGCGGCGGCGCGGCACTGGCGCTGGCCGTCGCCTCGCTCGCCGGATGCGGGGGCG
GCGATTCGGGCGAACCCGCTCCACGCGAATTCGCGCCCCCGACAGTGCAACTCGCCTACCCGACGCAACC
GAACTCGCCCGTCGCACCAGCGCCCACCGCGCACGTATCGAGCGGACACACGCCTCCGGCCACGGCGCCC
GCCGCGATGCCCACCGCTTCACCCACCGCGACGCCCACCGCTTCACCCACCGCGACGGCTGCCGCTTCGC
CCTCCGCGCCATCCACTGCGACGCCCAACGCCCCGCCCGCCGCTCCGCCGGCCGTCGTCGCCACCCGCGT
CCCGCCGACGCACGCGGCGTTGCGCCGCCCGACGATCGAACTCGAATTCGATCGCGCGATCGAGCCGGGT
TCAGTCCCACACATCGCGCTGCGCGCCGACGATGGCACGAGCGTCGCCGTCGGCCCGTTGTCGTGGCTGA
GCGATCGCCGGATCGCGTTCGCGCCGCGCAAACTGCTCAAGTCGAACAGCCGCTACGAAATCATGGTGCC
CGCCGGCATCAGGAGCACCACGGGCGAACGGTCGACCCATCCGCTAACGAGCAGCTTCGATACCGCGCCC
GTCACGCCGCCGCGCGGCCTGCCCAATCTCGACGGCGCCTCGTGCTTCATCAACACGGCGCTGCAATTGG
CGGTTCACTCGTCGGCGCTCGACGACATTCTGTCGAACGAAGCCGTCCCGCCCGCCGTCCGCACGCTGCT
CGAAGACTACGACGCCGCATCGGCTGACGCACTCGACGCGCAGTTGGCCGCCGCGGTCGCCGCGCTGCGC
GAGAGGCTGCGCATTCCCGGCGGAGAGGCTGGGCCCGTGCAGGAAGCGCTGAAGGAAATGGGCATGCCGC
TCCATGAGACGTTCGACGTATCTGACATACACAGCGCACCCGCAGGCACCAAGGCGTTCATACTGAACAG
CTCGTACGACTATGCGGCGCTCCCGAACCACGACCGGCTGGTCGCATTCAGCTACTACACGGGCGGTCAC
TATCTCGCCTATGTGAAGCGGGATGGAATCTGGTATAGCGTCGACGATGCGCGGGTCAGCGAGGTCAGTG
AGCAGCAGTTGCGCGACTTGACCCCGTTGTTCCATCATCCGACGAACTCGGATGTCAGTGGCGCGGCGAT
CGAAATCGCGATCTATCGATGA