SecReT6
Effector Protein ID: 526457937
-
SecReT6 ID834
T6SS typeA4b
Gene symbol-
Locus tagBDL_5913
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome I [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]3001035..3003275 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I3226
Description
UniProt IDS5NEW9
KEGG IDbpse:BDL_5913
PDB IDNA
Domain hit(s) vs Pfam DUF3274 [PF11678], Evalue: 1.00E-119, Aligned region: 416..725
Abhydrolase_6 [PF12697], Evalue: 0.00016, Aligned region: 38..61
Abhydrolase_6 [PF12697], Evalue: 0.00016, Aligned region: 226..311
DUF900 [PF05990], Evalue: 0.0056, Aligned region: 37..46
DUF900 [PF05990], Evalue: 0.0056, Aligned region: 213..283
PGAP1 [PF07819], Evalue: 0.0067, Aligned region: 38..43
PGAP1 [PF07819], Evalue: 0.0067, Aligned region: 249..302
Thioesterase [PF00975], Evalue: 0.0083, Aligned region: 147..188
Thioesterase [PF00975], Evalue: 0.0083, Aligned region: 258..359
Protein Sequence: 746 a.a.     [Download]
>gi|526457937|ref|YP_008329676.1| hypothetical protein BDL_5913 [Burkholderia pseudomallei MSHR305]
MNGINDQCFTAARGAGVTMSNRPGDRPVPIPRDLPGVVIFIHGVNDPGAAYATVERGLCQGLNERLSRSD
LRPGAYGGEYAEAIKAKDQKSPFFDSRIANDPDMYLYRRAETGGTHSMFLPFYWGYRASDDEIAKISHPG
EVKSRVADSDGNLMTRGQYQDIHGNRLDAHFGKGGGFFANATNNIPQMYSPGFEPDKLERTVMQNALAGN
TIFAGKSPDRRYFVLAAARLASLIRTIRAVRPSALALEHGMDPRHETITVMGHSQGTIITLLAQAMLKQQ
GQRCVDCIIMVDTPYSLQFTQDGSQQTGHAKLKTLVDIVNAVTSEPHTIPELAELMIDSAHSCGRAGQNW
SKTQGKRPDKGGKHWITFDERDNRGKVYLYFCPEDTVVGLDKVRGIGTFGVPDEVPADGAAASRGKTMPA
MTVLEPKRFFQRMWTRLERDQDGRGKRSKVAVGTPPARVPVRDPFQRLTPGPDTDGTMLGTLVESGKNMA
LQASFKRNDIRFINGEQLKPAYEPDLYGGEVRKGGQVPGHADVAGLMRPDDVTKNVALGNQYAKFKWKDV
ATTDDPGAGIEPHKQAFNRGRPVDEQSHNWRIVPSRSLGSMLSAAATGGRYQTYVIQREETPDEVRKRMR
TDADQLEANNYHSGVLLSSENHRWVTAMDVAIGQAVTLDDPDWRQLLLLMADWKMTPSAQKKITNCKSFA
RLDDHTQGFIDACAKYYQKGLFPSEKFVSLALPSLITSELKLDQKT
-
Nucleotide Sequence: 2241 bp     [Download]
>gi|526456747|ref|NC_021877.1|:3001035-3003275 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
ATGAACGGAATCAACGATCAGTGTTTCACCGCCGCCCGCGGGGCGGGCGTGACGATGTCGAATCGGCCCG
GCGACCGGCCCGTGCCGATTCCGCGCGATCTGCCGGGCGTGGTGATCTTCATCCACGGCGTCAACGATCC
CGGGGCGGCTTATGCCACCGTGGAGCGCGGGCTGTGCCAGGGGCTCAATGAGCGCTTGTCGCGAAGCGAT
CTGCGGCCGGGGGCGTATGGCGGGGAATATGCCGAAGCCATCAAAGCGAAAGACCAAAAGAGCCCGTTCT
TCGATAGCAGAATCGCCAACGATCCGGACATGTATCTGTATCGACGTGCGGAGACCGGCGGCACTCACAG
CATGTTCCTGCCGTTCTACTGGGGCTATCGGGCGTCCGATGACGAGATCGCGAAGATCAGCCATCCGGGC
GAGGTCAAGAGCCGCGTCGCGGACAGCGACGGCAACCTGATGACGCGCGGCCAGTATCAGGACATCCACG
GCAACCGGCTCGACGCCCATTTCGGCAAGGGCGGCGGGTTTTTCGCCAACGCGACGAACAACATCCCGCA
GATGTACAGCCCGGGCTTCGAACCGGACAAGCTCGAGCGCACGGTCATGCAAAACGCGCTGGCCGGCAAT
ACGATCTTCGCCGGCAAGTCGCCCGATCGCCGCTATTTCGTGCTGGCCGCGGCTCGCCTGGCGAGCCTCA
TCCGGACCATTCGGGCCGTCCGGCCCTCCGCGCTCGCGCTGGAGCACGGCATGGATCCTCGGCACGAAAC
GATCACCGTGATGGGGCACAGCCAGGGCACGATCATCACGCTGCTCGCGCAGGCGATGCTCAAGCAGCAA
GGGCAGCGCTGCGTCGATTGCATCATCATGGTCGATACGCCGTACAGCCTGCAGTTCACCCAGGACGGCA
GCCAGCAAACCGGGCACGCGAAGCTCAAGACGCTGGTCGACATCGTCAACGCGGTGACGAGCGAGCCGCA
TACGATTCCGGAGCTGGCCGAACTGATGATCGATTCGGCCCATTCGTGCGGCCGGGCCGGACAGAACTGG
AGCAAGACGCAGGGAAAGCGGCCGGACAAGGGCGGCAAGCACTGGATCACGTTCGACGAGCGCGACAACC
GCGGCAAGGTCTATCTGTACTTTTGCCCGGAAGATACCGTGGTCGGCCTCGACAAGGTGCGGGGGATCGG
CACGTTCGGCGTGCCCGACGAGGTACCGGCCGATGGCGCGGCGGCCAGCCGGGGCAAAACGATGCCCGCG
ATGACGGTGCTTGAGCCGAAGCGCTTCTTTCAGCGCATGTGGACGCGGCTCGAGCGCGACCAGGACGGCA
GGGGGAAGCGCTCGAAGGTCGCCGTCGGCACGCCGCCCGCGCGCGTGCCGGTTCGCGACCCGTTTCAGCG
ATTGACGCCGGGCCCCGACACGGACGGCACGATGCTTGGCACCTTGGTCGAATCCGGCAAGAACATGGCG
CTGCAGGCATCGTTCAAGCGCAACGACATTCGCTTCATCAACGGCGAGCAACTGAAACCGGCGTACGAGC
CCGATCTGTACGGGGGCGAGGTTCGGAAGGGCGGACAGGTGCCCGGGCACGCCGATGTCGCCGGGTTGAT
GCGTCCGGACGACGTGACGAAAAACGTCGCGCTCGGCAACCAGTACGCGAAGTTCAAATGGAAAGACGTC
GCGACGACGGACGATCCGGGCGCCGGCATCGAGCCGCACAAGCAGGCGTTCAATCGCGGCCGTCCGGTCG
ACGAGCAGTCGCATAACTGGCGCATCGTGCCGAGCCGGTCGCTCGGCTCGATGCTGTCGGCGGCCGCCAC
GGGCGGACGGTATCAGACGTACGTGATCCAGCGCGAGGAGACGCCGGACGAGGTTCGCAAGCGCATGCGT
ACCGATGCCGATCAACTGGAAGCGAACAACTATCATTCGGGCGTACTGCTCAGTTCGGAGAACCATCGCT
GGGTCACGGCGATGGACGTGGCGATCGGCCAGGCGGTGACGCTGGATGATCCGGACTGGCGGCAGTTGTT
GCTTTTGATGGCGGATTGGAAGATGACGCCGAGTGCACAGAAGAAGATAACGAACTGCAAGAGCTTTGCC
CGTTTGGATGATCATACCCAGGGTTTTATTGATGCATGCGCGAAGTACTATCAGAAGGGCCTATTCCCGT
CTGAGAAGTTCGTTTCGCTCGCCCTGCCGTCGCTGATCACAAGTGAACTGAAACTTGATCAGAAAACGTG
A