SecReT6
Effector Protein ID: 526458084
-
SecReT6 ID834
T6SS typeA4b
Gene symbol-
Locus tagBDL_5445
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome I [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]2438213..2439118 [+]
ProductD-mannose binding lectin family protein
Effector typeProtein
Homologous effectorBTH_II0310
Description
UniProt IDS5NM18
KEGG IDbpse:BDL_5445
PDB IDNA
Domain hit(s) vs Pfam B_lectin [PF01453], Evalue: 8.90E-11, Aligned region: 87..134
B_lectin [PF01453], Evalue: 8.90E-11, Aligned region: 190..229
Protein Sequence: 301 a.a.     [Download]
>gi|526458084|ref|YP_008329208.1| D-mannose binding lectin family protein [Burkholderia pseudomallei MSHR305]
MKKYALALWFMLVSSMSAMAGAIIPSGATLVAGQYAISNNGNFAFGVDAASGKLYFHYRFPTQAWGASAM
SQMYGTQPEGALYVGKGDRLVMQTDGRLVFYSGNDVVWSNWYYGPAPIPGSYAVVEDFGVVAIYPPQGGY
PTFTWPFASVTPNSGALATVVGYPFGVNFPVLNGRQWLQIFNNVTYYLWNKSFAADSVAMQTDGNLVVYN
KGQPVWSTGTSGNPGAYMLVTPVGFVLGKQYGGILANVPYPVSVDQSSRASGPNDPKPTPAAPPPPSLNL
PINASWKCYYVKDWLACYAPG
-
Nucleotide Sequence: 906 bp     [Download]
>gi|526456747|ref|NC_021877.1|:2438213-2439118 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
GTGAAAAAATACGCATTGGCGCTCTGGTTCATGCTGGTTTCATCGATGTCGGCAATGGCGGGGGCGATCA
TTCCATCGGGCGCAACGCTGGTTGCGGGGCAATACGCGATATCGAACAACGGCAACTTCGCGTTCGGCGT
CGACGCCGCCAGCGGCAAGCTCTATTTCCACTACAGGTTCCCGACGCAGGCGTGGGGCGCGAGCGCGATG
TCGCAAATGTACGGAACGCAGCCCGAGGGCGCGCTCTACGTCGGCAAGGGCGACCGGCTCGTGATGCAGA
CCGACGGGCGACTCGTGTTCTATTCGGGCAACGACGTCGTCTGGAGCAACTGGTATTACGGCCCCGCGCC
GATCCCCGGCTCGTATGCGGTCGTCGAGGATTTCGGCGTCGTCGCGATCTATCCGCCGCAGGGCGGCTAT
CCGACGTTCACCTGGCCGTTCGCGTCGGTCACGCCGAACAGCGGCGCGCTCGCGACGGTGGTCGGCTATC
CGTTCGGCGTGAACTTCCCGGTGCTCAACGGGCGCCAATGGCTGCAGATCTTCAACAACGTCACTTACTA
CCTGTGGAACAAGAGCTTCGCCGCGGACAGCGTCGCGATGCAGACCGACGGCAATCTCGTCGTCTACAAC
AAGGGGCAGCCGGTCTGGTCGACGGGAACGTCGGGCAATCCGGGCGCCTACATGCTGGTGACGCCTGTCG
GCTTCGTGCTCGGCAAGCAGTACGGCGGCATCCTCGCGAACGTGCCCTACCCGGTGTCCGTCGATCAGTC
GAGCCGCGCGAGCGGCCCGAACGATCCGAAGCCGACGCCGGCCGCGCCGCCGCCGCCCTCGCTGAACCTG
CCGATCAATGCGAGCTGGAAGTGCTATTACGTGAAGGACTGGCTCGCGTGCTACGCGCCGGGTTGA