SecReT6
Effector Protein ID: 526459071
-
SecReT6 ID834
T6SS typeA4b
Gene symbol-
Locus tagBDL_5912
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome I [GenBank: NC_021877] [Browse all T6SS(s) in this replicon]
Location [Strand]2998229..3001021 [+]
ProductRhs element Vgr family protein
Effector typeProtein
Homologous effectorBTH_I3225
Descriptiontype VI secretion system Vgr family protein
UniProt IDS5P2Z7
KEGG IDbpse:BDL_5912
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.00E-57, Aligned region: 47..378
DUF2345 [PF10106], Evalue: 5.20E-42, Aligned region: 614..646
DUF2345 [PF10106], Evalue: 5.20E-42, Aligned region: 702..853
T6SS_Vgr [PF13296], Evalue: 3.20E-39, Aligned region: 563..671
T6SS_Vgr [PF13296], Evalue: 3.20E-39, Aligned region: 742..807
Phage_base_V [PF04717], Evalue: 1.40E-18, Aligned region: 462..546
Protein Sequence: 930 a.a.     [Download]
>gi|526459071|ref|YP_008329675.1| Rhs element Vgr family protein [Burkholderia pseudomallei MSHR305]
MTNLNDTLRNFASGAVDWNKRPVALHFGAAQAALGHLLALQHASVQEGLMTGIHGRLTCVSTRRDLPPGV
LLGIPVSIRLITDRGQPHTVSAIISGVQIGQSDGELCVYQLTVCDALSLMDKRTNSRVFRKRSVIDVLAT
LFNEWQQRSPALARAFEFDLSGLRADRYPPRELTRQVNESDAHFVRRLLRREGITVFAKAGPAKGERPLQ
GDAPVHTLVCCDDPMSLPQAPAGTVRLHPRDGGAAQRDTVTLFALRRQLAPGKAGRPSWDYKKARIDESS
VASSLDQGEAGNDLAKLLTDIAIDIAHAGDSWRDHERLTRARMLAHEFEAERHDGVSSVRDLAVGTWITL
TGDPQWDRQRADKRQFVITSIDHDIWNNLPKGLNERVHALFAASRNLACAPRALPSALANDADTRYENTF
ACVRRGVPLAPAYDPQADLPPAHLLTGTIVGAEGEEVFCDEDGRVRVRVHGLDPADHAHAQGAGTNGNAG
DSAPIRVASSLAGAYFGASFLPRVGMEVLLGCLGGDPDRLVIIGVLGNGAHPPATFSHAGGLPGNRYLSG
IKTKEIRGQRYNQLRLDDTPNQISAQLASEHAHSQLNLGYLTQPRENGHGNDRGEGVELRTDAAAALRAA
QGMLLTTYARTQASGGQLDRDELIRLLGECAELFKALGDYAGQHGGQAADTAGQHAVAAAFKRWAPGTGT
GTDGADAPSDGAARALMAFGAQAGSVNVTPKTHVTYAGENIDQVAQQHLQLMSGQRLNATAGQGMQLFAR
GAGVQAVAGEGPMLLQAQAGTLTANAQKGVKITTNEHEVFVSAPKIRLVAEDGSYLELGGGITLGTNGDI
KLLSASHQWGGPSTAQAAKSGFGNQPTDQRFKLHYPGEDGDLQAAANKRFRITLDDGRVIEGKTDASGLT
DLVKDDAMRIAKIDYLKPKL
-
Nucleotide Sequence: 2793 bp     [Download]
>gi|526456747|ref|NC_021877.1|:2998229-3001021 Burkholderia pseudomallei MSHR305 chromosome 1, complete sequence
GTGACCAATTTGAACGATACGCTACGCAATTTTGCGTCGGGGGCGGTCGACTGGAATAAACGTCCGGTCG
CGTTGCACTTTGGCGCCGCGCAGGCCGCGCTGGGCCACCTCCTCGCGCTGCAGCACGCCAGTGTTCAGGA
AGGGCTGATGACCGGGATCCACGGCCGATTGACCTGCGTGTCGACCCGCCGCGACCTTCCGCCCGGCGTG
TTGCTCGGCATTCCGGTTTCGATCCGGCTGATTACCGACCGCGGACAGCCGCACACGGTGAGCGCGATCA
TCAGCGGCGTCCAGATCGGCCAAAGCGACGGCGAGCTCTGTGTGTACCAGCTGACGGTCTGCGACGCGCT
GTCGCTGATGGACAAGCGCACCAATTCGCGGGTCTTCCGAAAGCGCAGCGTCATCGATGTGCTCGCCACG
CTGTTCAACGAATGGCAGCAGCGCAGCCCGGCCCTCGCGCGCGCGTTCGAATTCGATCTGTCCGGCTTGC
GCGCCGATCGCTATCCGCCCCGCGAGCTGACCCGGCAGGTCAACGAATCGGATGCGCATTTCGTGCGCCG
TCTGCTGCGCCGCGAAGGGATCACCGTGTTCGCGAAGGCGGGGCCGGCGAAGGGCGAGCGGCCGTTGCAG
GGCGACGCGCCCGTGCACACGCTCGTGTGCTGTGACGATCCGATGTCGTTGCCGCAAGCGCCGGCCGGCA
CGGTCCGCTTGCATCCGCGCGACGGCGGCGCCGCGCAGCGCGACACGGTCACGCTGTTCGCGCTGCGTCG
GCAATTGGCGCCCGGCAAGGCCGGCCGCCCGTCGTGGGACTACAAGAAGGCGCGGATCGACGAATCGAGC
GTCGCTTCGAGCCTCGATCAGGGCGAGGCGGGCAACGATCTGGCGAAGCTGCTGACCGACATCGCGATCG
ACATTGCGCACGCGGGCGATTCATGGCGCGATCACGAGCGGCTCACCCGCGCGCGCATGCTCGCGCACGA
GTTCGAAGCCGAGCGCCATGACGGCGTCAGCAGCGTGCGGGATCTCGCCGTGGGCACATGGATCACGCTG
ACGGGCGATCCGCAATGGGACAGGCAACGCGCCGACAAGCGTCAGTTCGTGATCACGTCGATCGATCACG
ACATCTGGAACAACCTGCCGAAGGGGCTCAACGAGCGCGTGCACGCGCTGTTCGCCGCGAGCCGCAATCT
CGCGTGCGCGCCCCGCGCGCTGCCGTCCGCGCTGGCGAACGACGCGGATACCCGCTACGAGAACACGTTC
GCGTGCGTGCGCCGCGGCGTGCCGCTTGCGCCCGCGTACGATCCGCAAGCCGATTTGCCGCCCGCGCATC
TGCTCACGGGCACGATTGTCGGCGCGGAGGGCGAAGAAGTGTTCTGCGACGAAGACGGCCGGGTGCGCGT
GCGGGTGCACGGCCTCGATCCGGCGGATCACGCGCACGCGCAGGGCGCGGGCACCAACGGCAACGCGGGC
GACAGCGCGCCGATCCGCGTGGCGTCGAGCCTCGCCGGCGCCTATTTCGGCGCATCGTTCCTGCCGCGAG
TCGGCATGGAAGTCCTCCTCGGGTGTCTCGGCGGCGATCCGGACCGGCTGGTGATCATCGGCGTGCTCGG
TAACGGCGCGCATCCGCCGGCGACGTTCAGCCACGCGGGCGGGCTGCCGGGCAACCGCTACCTGTCGGGC
ATCAAGACGAAGGAGATTCGTGGGCAACGGTACAACCAGCTGCGTCTCGACGACACGCCGAACCAGATCA
GCGCGCAACTGGCGAGCGAGCACGCGCATTCGCAGCTCAATCTCGGATATCTGACGCAACCGCGCGAGAA
CGGCCACGGGAACGACCGCGGCGAGGGCGTGGAGTTGCGTACCGACGCGGCGGCGGCGCTGCGGGCGGCG
CAAGGCATGCTGCTGACGACCTACGCGCGCACGCAGGCGAGCGGCGGGCAACTGGACCGTGACGAGCTGA
TTCGGTTGCTCGGCGAATGCGCGGAGCTGTTCAAGGCGCTGGGCGACTACGCGGGGCAGCACGGCGGGCA
GGCCGCGGATACGGCCGGCCAGCACGCGGTGGCCGCCGCGTTCAAGCGCTGGGCGCCGGGCACGGGCACG
GGCACGGACGGCGCCGATGCGCCGTCCGACGGCGCAGCGCGCGCGCTGATGGCGTTCGGCGCGCAGGCCG
GTTCGGTGAACGTCACGCCGAAGACGCATGTGACGTATGCCGGCGAGAACATCGATCAGGTCGCGCAGCA
GCACCTGCAACTGATGAGCGGCCAGCGGCTGAACGCGACGGCCGGGCAGGGCATGCAGCTCTTCGCGCGG
GGCGCGGGGGTGCAGGCCGTGGCGGGCGAAGGGCCGATGCTGCTGCAGGCGCAAGCCGGCACGCTGACGG
CGAACGCGCAGAAGGGCGTCAAGATCACGACGAACGAGCACGAGGTGTTCGTGAGCGCGCCGAAGATTCG
GCTCGTTGCCGAGGACGGCAGCTACCTCGAGCTCGGCGGCGGCATCACGCTCGGCACGAACGGCGACATC
AAGCTGCTGTCGGCGTCGCACCAGTGGGGCGGGCCGTCGACCGCGCAGGCGGCGAAGAGCGGGTTCGGCA
ATCAGCCGACGGATCAGCGTTTCAAGCTGCACTATCCGGGCGAGGACGGCGATTTGCAGGCGGCGGCGAA
CAAGCGGTTCCGGATCACGCTGGACGACGGGCGCGTCATCGAAGGCAAGACCGACGCGAGCGGCCTGACG
GATCTGGTCAAGGACGACGCGATGCGTATCGCGAAGATCGACTATCTGAAACCGAAGCTCTGA