SecReT6
Effector Protein ID: 526470565
-
SecReT6 ID834
T6SS typeA4b
Gene symbol-
Locus tagBDL_2305
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome I [GenBank: NC_021884] [Browse all T6SS(s) in this replicon]
Location [Strand]2681028..2681531 [+]
Producttype VI secretion system effector, Hcp1 family protein
Effector typeProtein
Homologous effectorBCAL0343
DescriptionHcp protein
UniProt IDS5P5K6
KEGG IDbpse:BDL_2305
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.40E-45, Aligned region: 6..139
Protein Sequence: 167 a.a.     [Download]
>gi|526470565|ref|YP_008342444.1| type VI secretion system effector, Hcp1 family protein [Burkholderia pseudomallei MSHR305]
MLHMHLKFGSPAIKGESADKDHEGWIELKSWDHSIVQPRSATASTAGGHTATRCEHGDMVFTKEIDSSSP
LLYQHASGGTTFDEVTIDFLRADGEGQRVKYLEIKLKYVIISSIAPSVHTEGLPVETFSLKYAAVQWKQT
QQKIGGNQGGNTQGAWSLTKNDKTYAV
-
Nucleotide Sequence: 504 bp     [Download]
>gi|526469930|ref|NC_021884.1|:2681028-2681531 Burkholderia pseudomallei MSHR305 chromosome 2, complete sequence
ATGTTACACATGCATTTGAAGTTCGGTAGTCCCGCCATCAAGGGCGAGTCCGCCGACAAGGACCACGAAG
GCTGGATCGAGCTGAAATCCTGGGATCACTCGATCGTTCAGCCGCGTTCGGCGACCGCATCGACGGCGGG
CGGCCACACGGCGACGCGTTGCGAGCACGGCGACATGGTGTTCACGAAGGAAATCGATTCGTCGAGCCCG
CTGCTGTATCAGCACGCGTCGGGCGGCACCACGTTCGACGAAGTGACGATCGATTTCCTGCGCGCGGACG
GCGAAGGCCAGCGCGTGAAGTATCTCGAGATCAAGCTGAAGTACGTGATCATCTCGAGCATCGCGCCGAG
CGTGCATACCGAAGGCCTGCCGGTCGAGACCTTCTCGCTGAAGTACGCCGCGGTCCAGTGGAAGCAGACG
CAGCAGAAGATCGGCGGCAACCAGGGCGGCAACACGCAGGGCGCCTGGAGCCTCACGAAGAACGACAAGA
CCTACGCGGTCTAA