SecReT6
Effector Protein ID: 526470659
-
SecReT6 ID834
T6SS typeA4b
Gene symbol-
Locus tagBDL_1877
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome I [GenBank: NC_021884] [Browse all T6SS(s) in this replicon]
Location [Strand]2227029..2227469 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I0068
DescriptionTae2
UniProt IDS5NTM4
KEGG IDbpse:BDL_1877
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 146 a.a.     [Download]
>gi|526470659|ref|YP_008342030.1| hypothetical protein BDL_1877 [Burkholderia pseudomallei MSHR305]
MPYVSTHYSNNASAPVGRWTCAPTSKLAPFDKAPTGSITSGVDLCGQCVSYVKGVCPTLPLTGQWRKGAP
VKGNATIVAGTVIATFNAAGKYDGHAAIYVSQTKDGGILVYDQFVTPPTPQPVRQRRLRWGAHGRSNNGD
NFYVVE
-
Nucleotide Sequence: 441 bp     [Download]
>gi|526469930|ref|NC_021884.1|:c2227469-2227029 Burkholderia pseudomallei MSHR305 chromosome 2, complete sequence
ATGCCTTACGTGTCGACCCATTACTCGAACAACGCCAGCGCGCCGGTCGGCCGCTGGACCTGCGCGCCGA
CTTCGAAGCTCGCGCCTTTCGACAAGGCGCCGACGGGCAGCATCACGTCCGGCGTCGATCTGTGCGGCCA
ATGCGTGTCCTACGTGAAAGGGGTCTGCCCGACGCTGCCGCTCACCGGGCAATGGCGCAAGGGCGCGCCG
GTGAAAGGCAACGCGACGATCGTCGCGGGCACCGTGATCGCGACGTTCAACGCCGCCGGCAAGTACGACG
GCCACGCGGCGATCTACGTCAGCCAGACGAAGGACGGCGGCATCCTGGTGTACGACCAGTTCGTGACGCC
GCCGACGCCGCAGCCGGTTCGGCAACGGCGCCTGCGCTGGGGCGCGCATGGTCGGTCGAACAATGGGGAT
AACTTCTATGTCGTGGAGTAA