SecReT6
Effector Protein ID: 526472353
-
SecReT6 ID834
T6SS typeA4b
Gene symbol-
Locus tagBDL_577
StrainBurkholderia pseudomallei MSHR305
Repliconchromosome I [GenBank: NC_021884] [Browse all T6SS(s) in this replicon]
Location [Strand]716460..719483 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I2691
Description
UniProt IDS5NWT6
KEGG IDbpse:BDL_577
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 1007 a.a.     [Download]
>gi|526472353|ref|YP_008340749.1| hypothetical protein BDL_577 [Burkholderia pseudomallei MSHR305]
MAGSDDRCDVCKLQGLAVYPSRYAVVPKTFDAPALGPFDDKSVTGVALTQSKYGLRQLREGFVYLLYESG
PRGPFHWEVYSVAPDGTLWKQLDTASVKRVSAPQACQRKGHSASRVQYLVIEKPHQCGNVWIAFSEWPWS
QDTVKRYGGNDANAASLRKKRMQLIEPSTWISAPKPGPYSAPLTEANLQRVIEHAPAIATTAKGEPVGLL
SAELPEAVSYGDVGAFRDARLQICTSRYPWAMRNKAAAGAKLSSAAETVKGAQGSTRNTKGEPCVPLMVA
LWDGIGITHELNGFRNDAQARFLQYCDEQALRINALQWIDQAKLAVEAGARRKATFDHSPAMPGSTSWYY
PDAVAKQKAAAKAPADRQFWNDYQWMGENGVPPSYARQITQFRAAPSSPAYQDAMARARKYVEAKPRIEQ
DRAKKIDQDTVTGAEHDWAKYREKLADDTSSKKGASNGNVKRIDVFRVLYQRIQDQKQALLAQRTADVAS
WLDAPLFLSALEDYHEENGFDGIAFEFAIFHAIVGLSAERSGVAALNKLIDRLDPTKPESLVWRMVASNQ
KKSKEALKLALAKAEANKNVVLETVGEGFNVFAETSEKLKKFAEFYTKMDEMSKQAKQLNAIDQAMHDKG
VDKVVVSVGHLVFQRFPYKGADLAGLGNGVSEAIIKSVFMLRVGIKSEEVKDLVLQQAKVEPQLRSKFLG
EYQTQRRMGRSSPEAFRMATSAVAKTEGSNVLANRWSKLKVRESVGLVGVIGLIEVIGLIKLINKSDKEG
RDWAELGGACFSVAGAAAEVALKPLETLKFEQGAKNVKILGGYCGAIAGGIGMVFDLMDARGKWKNGEQL
VGLLYVGKGILGFGATVAFGLTALSSSAPFFERIASNVTGRKIRIVVLDRVGQGIVDAAARKAAIAAGQE
AAAVAAERAGAMVVGRVLLFMASWEIQVAVIAIQVVIWALSNDDLQNAMLDSVFGMERKYKVVADLKRQD
EAFDKALVAVGFKSEETDEKGKAGQNG
-
Nucleotide Sequence: 3024 bp     [Download]
>gi|526469930|ref|NC_021884.1|:c719483-716460 Burkholderia pseudomallei MSHR305 chromosome 2, complete sequence
ATGGCGGGAAGCGACGATCGTTGCGACGTTTGCAAGCTTCAGGGGCTGGCGGTCTATCCGTCGCGCTACG
CGGTGGTGCCAAAAACCTTCGACGCGCCAGCGCTCGGACCATTCGACGACAAGAGCGTCACGGGCGTGGC
GCTCACGCAAAGCAAGTACGGCTTGCGTCAACTCCGCGAGGGCTTCGTCTATTTGCTCTACGAATCGGGC
CCGCGCGGCCCGTTTCATTGGGAAGTGTATTCAGTCGCGCCGGACGGCACGCTCTGGAAGCAGCTGGATA
CGGCGAGCGTGAAGCGGGTGAGCGCTCCACAGGCTTGTCAGCGAAAGGGGCATAGCGCGTCGCGTGTCCA
GTATCTCGTCATCGAGAAACCACATCAGTGCGGCAATGTCTGGATCGCGTTCAGCGAATGGCCATGGAGC
CAAGACACGGTTAAGCGTTACGGCGGCAACGACGCGAACGCCGCCAGTCTGCGCAAGAAACGCATGCAAC
TCATCGAGCCTTCGACGTGGATATCCGCGCCGAAGCCGGGACCGTATTCGGCGCCGCTGACCGAAGCCAA
TCTGCAGCGCGTCATCGAACATGCGCCCGCTATCGCGACCACGGCGAAAGGCGAACCCGTCGGCCTGCTC
AGCGCGGAGCTGCCGGAGGCGGTCAGCTACGGGGACGTGGGCGCGTTTCGCGACGCTCGCCTGCAAATTT
GTACGTCGCGTTACCCGTGGGCCATGCGCAACAAGGCTGCGGCGGGTGCAAAGCTTAGTTCCGCGGCAGA
AACGGTCAAGGGCGCGCAGGGCAGTACCCGAAACACAAAGGGTGAGCCGTGCGTGCCGTTGATGGTGGCT
CTGTGGGACGGCATCGGGATCACGCACGAACTGAACGGCTTCCGTAACGATGCGCAGGCGCGTTTTCTGC
AGTATTGCGACGAGCAGGCGCTCCGAATCAATGCGCTGCAGTGGATTGATCAGGCGAAGCTCGCGGTGGA
AGCCGGTGCGCGCAGAAAGGCGACGTTCGATCATAGTCCGGCCATGCCGGGCAGTACGAGCTGGTATTAC
CCGGATGCCGTTGCGAAGCAAAAGGCGGCCGCGAAGGCTCCGGCGGATCGGCAGTTCTGGAACGATTATC
AGTGGATGGGGGAAAACGGCGTACCGCCGTCATACGCCAGACAGATCACGCAGTTTCGCGCTGCGCCGTC
ATCGCCGGCCTATCAGGATGCGATGGCGAGAGCGCGCAAGTATGTCGAGGCCAAGCCGAGAATCGAGCAG
GATCGCGCGAAGAAGATCGACCAGGACACGGTTACCGGAGCCGAGCACGATTGGGCGAAGTACCGCGAGA
AATTGGCGGACGATACGTCGAGCAAGAAAGGGGCGTCCAATGGGAACGTCAAACGTATCGACGTTTTTCG
CGTCCTGTACCAGCGTATCCAGGACCAAAAGCAGGCGTTGCTCGCGCAGCGGACAGCGGATGTCGCGAGC
TGGCTGGATGCGCCGCTTTTTCTGTCGGCGCTGGAGGATTATCACGAAGAGAACGGCTTCGACGGGATTG
CGTTCGAGTTTGCCATTTTCCATGCGATCGTCGGATTGAGCGCCGAGCGAAGCGGCGTGGCCGCATTGAA
CAAGCTGATCGATCGCCTGGATCCGACGAAGCCGGAGAGCCTCGTTTGGCGAATGGTGGCGAGCAACCAG
AAGAAATCGAAGGAAGCGCTGAAGCTCGCGCTCGCGAAGGCGGAGGCGAACAAGAACGTCGTACTGGAGA
CGGTCGGCGAAGGATTCAACGTATTCGCGGAAACGTCCGAAAAGCTGAAGAAGTTCGCCGAGTTTTACAC
GAAGATGGACGAAATGAGCAAGCAGGCCAAACAGCTCAACGCCATTGATCAGGCAATGCACGACAAGGGC
GTCGACAAGGTGGTCGTCAGTGTCGGGCATCTTGTTTTTCAGCGCTTTCCGTACAAGGGGGCCGATTTGG
CGGGCCTTGGAAACGGCGTGAGCGAGGCGATCATCAAGTCCGTGTTCATGCTGCGGGTCGGCATCAAGAG
CGAAGAGGTGAAGGATCTCGTCTTGCAGCAAGCCAAGGTGGAGCCGCAGCTTCGGAGCAAGTTCCTCGGA
GAGTACCAGACGCAGCGCCGAATGGGACGCAGTTCGCCGGAAGCCTTCCGGATGGCCACGTCGGCTGTTG
CCAAGACCGAAGGCTCGAACGTGCTGGCCAATCGGTGGAGCAAGCTCAAGGTGCGCGAGAGTGTCGGCCT
TGTGGGCGTGATCGGGCTGATCGAAGTGATCGGGTTGATCAAGCTGATTAACAAGAGCGACAAGGAAGGG
CGGGATTGGGCTGAATTGGGCGGCGCATGTTTTTCGGTGGCGGGCGCTGCGGCGGAGGTTGCGCTTAAGC
CCTTGGAGACGCTCAAATTCGAACAGGGGGCGAAGAACGTCAAGATACTTGGTGGGTACTGCGGAGCGAT
TGCGGGAGGCATCGGAATGGTATTCGATTTGATGGATGCGAGGGGGAAATGGAAAAACGGCGAACAGTTA
GTTGGTCTTCTTTATGTAGGTAAGGGCATTCTCGGATTCGGCGCCACGGTGGCATTTGGTTTAACCGCTT
TGAGTTCATCCGCGCCATTCTTCGAGCGCATCGCATCGAATGTTACTGGCCGAAAAATTCGTATCGTCGT
CCTCGATCGTGTCGGGCAAGGCATTGTCGATGCGGCGGCGCGCAAGGCAGCCATTGCTGCAGGTCAGGAA
GCCGCAGCCGTTGCTGCGGAACGGGCTGGAGCCATGGTGGTGGGCAGGGTGCTTTTGTTTATGGCCAGTT
GGGAAATTCAGGTCGCCGTTATAGCTATTCAAGTCGTGATTTGGGCGCTAAGCAATGATGATTTGCAGAA
CGCCATGCTCGATTCGGTGTTTGGGATGGAGCGGAAATATAAAGTAGTAGCTGATTTGAAGAGGCAAGAC
GAGGCCTTCGATAAGGCGTTAGTAGCAGTTGGCTTCAAGTCTGAAGAGACGGATGAAAAAGGTAAGGCAG
GGCAAAACGGGTAG