SecReT6
Effector Protein ID: 528817980
-
SecReT6 ID835
T6SS typeA3
Gene symbol-
Locus tagSN31241_12660
StrainSalmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1
Repliconchromosome [GenBank: NC_021902] [Browse all T6SS(s) in this replicon]
Location [Strand]1305691..1306176 [+]
ProductHemolysin-coregulated protein
Effector typeProtein
Homologous effectorEvpC
DescriptionHcp protein
UniProt IDS5SL84
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-41, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|528817980|ref|YP_008359183.1| Hemolysin-coregulated protein [Salmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1]
MAYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSGLGSGKVSVTNLDFDHYIDRASPNLF
KYCASGKHIPQAILVMRKAGGNPLEYLKYTFTDLIVAVVSPSGSHDGEIASRETVELSFSTVKQEYVVQN
QQGGSGGTITAGYDFKANKEI
-
Nucleotide Sequence: 486 bp     [Download]
>gi|528816716|ref|NC_021902.1|:1305691-1306176 Salmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1, complete genome
ATGGCTTATGACATTTTTTTGAAAATTGACGGCATTGATGGCGAGTCAATGGATGACAAACACAAAAATG
AAATTGAAGTACTGAGCTGGCGCTGGAATATTCATCAGGAATCCACCATGCACGCCGGTAGCGGCCTCGG
CTCCGGTAAGGTCTCCGTCACCAACCTGGATTTTGATCACTATATCGACCGCGCCAGCCCGAACCTGTTC
AAATACTGCGCCTCCGGCAAGCACATTCCGCAGGCCATTCTGGTTATGCGTAAGGCTGGCGGCAATCCGC
TGGAGTACCTCAAGTATACCTTCACCGACCTGATTGTCGCCGTGGTTTCCCCGAGCGGCAGCCACGATGG
TGAAATCGCCTCCCGTGAAACGGTCGAGCTTTCTTTCAGCACTGTGAAACAGGAATACGTGGTGCAGAAC
CAGCAGGGCGGCAGCGGCGGCACTATCACCGCAGGCTACGACTTCAAGGCCAACAAAGAAATTTAA