SecReT6
Effector Protein ID: 528817981
-
SecReT6 ID835
T6SS typeA3
Gene symbol-
Locus tagSN31241_12670
StrainSalmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1
Repliconchromosome [GenBank: NC_021902] [Browse all T6SS(s) in this replicon]
Location [Strand]1306524..1306964 [+]
Productcytoplasmic protein
Effector typeProtein
Homologous effectorSTM0277
DescriptionTae4_TM
UniProt IDS5T1P6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF4285 [PF14113], Evalue: 3.10E-28, Aligned region: 25..126
Protein Sequence: 146 a.a.     [Download]
>gi|528817981|ref|YP_008359184.1| cytoplasmic protein [Salmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1]
MNHSVADVGSIIGGNVGKNITGGYFQNACPIRMSYVLNATGFPIARNSPYAKVSGADNKFYIYRVNDMID
YLTHTMGKPDLIVNNPKQSDFIGKKGIIVVKGHGWSNARGHVTLWNGSICSDQCHLLNDPDNGPFVPEVG
TLWILP
-
Nucleotide Sequence: 441 bp     [Download]
>gi|528816716|ref|NC_021902.1|:1306524-1306964 Salmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1, complete genome
GTGAATCATTCCGTCGCTGATGTGGGTAGCATTATTGGTGGAAACGTTGGGAAAAATATAACTGGTGGTT
ATTTTCAAAATGCCTGCCCTATTCGAATGAGCTATGTTTTGAATGCGACAGGGTTCCCAATAGCCCGTAA
CTCTCCGTATGCAAAGGTTAGTGGTGCCGATAATAAATTCTATATTTATCGCGTGAATGATATGATTGAT
TATCTTACTCATACTATGGGCAAGCCTGATCTTATTGTTAATAATCCGAAACAGAGTGACTTTATCGGGA
AGAAAGGAATTATCGTAGTAAAAGGGCATGGCTGGAGCAATGCCAGAGGACACGTTACATTATGGAATGG
CAGTATCTGTTCAGATCAGTGCCACTTATTAAATGACCCAGATAATGGACCATTTGTTCCTGAAGTTGGG
ACTCTGTGGATACTGCCGTGA