SecReT6
Effector Protein ID: 528820196
-
SecReT6 ID835
T6SS typeA3
Gene symbol-
Locus tagSN31241_34830
StrainSalmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1
Repliconchromosome [GenBank: NC_021902] [Browse all T6SS(s) in this replicon]
Location [Strand]3511450..3511851 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorSTY2606
DescriptionTae3_TY
UniProt IDS5T897
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CHAP [PF05257], Evalue: 0.00012, Aligned region: 27..99
Protein Sequence: 133 a.a.     [Download]
>gi|528820196|ref|YP_008361399.1| hypothetical protein SN31241_34830 [Salmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1]
MLLRILLTGIIMSWDKRVAVNYAKTHAGSHSQGRCAEFTRKAIQAGGITLGHTYHAKDYGPMLRSAGFTA
IGTYEMPREGDVIIIQPYAGGNPSGHMAIYDGAEWYSDFKQRDMWAGPGYRAARPSYTIYRKN
-
Nucleotide Sequence: 402 bp     [Download]
>gi|528816716|ref|NC_021902.1|:3511450-3511851 Salmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1, complete genome
TTGCTATTACGTATTTTATTAACAGGAATCATTATGAGTTGGGATAAAAGAGTGGCGGTTAATTATGCCA
AAACGCATGCAGGTTCTCATTCTCAAGGCCGGTGTGCGGAATTTACCCGAAAGGCAATTCAGGCGGGCGG
TATCACGCTGGGGCATACGTATCATGCGAAAGATTATGGCCCAATGTTAAGAAGCGCCGGATTCACCGCT
ATTGGCACCTATGAAATGCCGCGCGAGGGTGACGTCATCATTATTCAACCTTACGCTGGCGGAAACCCGA
GCGGTCACATGGCGATATACGATGGCGCAGAGTGGTATTCGGATTTTAAACAACGCGATATGTGGGCCGG
CCCGGGCTACCGGGCAGCCAGGCCCTCATATACCATCTACAGGAAGAATTAA