SecReT6
Effector Protein ID: 528986882
-
SecReT6 ID807
T6SS typeA4b
Gene symbol-
Locus tagNH44784_051341
StrainAchromobacter xylosoxidans NH44784-1996
Repliconchromosome [GenBank: NC_021285] [Browse all T6SS(s) in this replicon]
Location [Strand]5483776..5484279 [-]
ProductUncharacterized protein ImpD
Effector typeProtein
Homologous effectorBCAL0343
DescriptionHcp protein
UniProt IDR4Y0Q0
KEGG IDaxo:NH44784_051341
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.30E-41, Aligned region: 5..140
Protein Sequence: 167 a.a.     [Download]
>gi|528986882|ref|YP_008032199.1| Uncharacterized protein ImpD [Achromobacter xylosoxidans NH44784-1996]
MKDIYVKFGNPALKGESQDKDHPDWIEVGSWRHEIIQPRSATASTSGGHTAERTEHGEMVFTKDLDVVSP
LLYQHASGGTTFDEVTIDFLRADGEGNRVKYLEIKLKYVIISRVAPEVVSEGLPHESFSLKYAAVQWKYT
QQKVGGNQGGNSQGAWSLTKNDKTYSV
-
Nucleotide Sequence: 504 bp     [Download]
>gi|528981796|ref|NC_021285.1|:c5484279-5483776 Achromobacter xylosoxidans NH44784-1996 complete genome
ATGAAGGACATCTACGTCAAATTCGGCAATCCTGCGCTCAAGGGCGAGTCCCAGGACAAGGATCACCCGG
ACTGGATCGAAGTGGGCTCGTGGCGCCACGAGATCATCCAGCCGCGTTCGGCCACCGCCTCGACCTCGGG
CGGCCACACCGCCGAGCGCACCGAGCATGGCGAAATGGTCTTCACCAAGGACCTGGACGTGGTCAGCCCG
CTGCTCTACCAGCACGCTTCGGGCGGCACGACCTTTGACGAAGTGACCATCGACTTCCTGCGCGCCGACG
GCGAGGGCAATCGCGTCAAGTACCTGGAAATCAAGCTCAAGTACGTGATCATCTCGCGCGTCGCGCCCGA
AGTGGTCAGCGAAGGCCTGCCGCACGAATCGTTCTCGCTGAAGTACGCCGCGGTCCAGTGGAAGTACACG
CAGCAGAAGGTCGGCGGCAACCAGGGCGGCAATTCCCAGGGCGCCTGGAGCCTGACCAAGAACGACAAGA
CCTACTCGGTCTGA