SecReT6
Effector Protein ID: 529220957
-
SecReT6 ID837
T6SS typeA1
Gene symbol-
Locus tagI137_14985
StrainSalmonella enterica subsp. enterica serovar Pullorum str. S06004
Repliconchromosome [GenBank: NC_021984] [Browse all T6SS(s) in this replicon]
Location [Strand]3189934..3190419 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorROD_34191
DescriptionHcp protein
UniProt IDS5ULW7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.20E-38, Aligned region: 5..135
Protein Sequence: 161 a.a.     [Download]
>gi|529220957|ref|YP_008382387.1| hypothetical protein I137_14985 [Salmonella enterica subsp. enterica serovar Pullorum str. S06004]
MDAIFLKLDNIKGESQVEGFEDQIEIMSYSHNVAMQVNNDVSLTERTSGRAHVGEMSLTKFVDLATPVLN
EYCCSGRLIRTAVLTLCRNDDGKMRSLIVYTLTNVLISQLSVSGGAGGKPVETMSLNFTKIEWQITAEKS
DGAQQESRTSVWDLAMDQIGK
-
Nucleotide Sequence: 486 bp     [Download]
>gi|529218781|ref|NC_021984.1|:c3190419-3189934 Salmonella enterica subsp. enterica serovar Pullorum str. S06004, complete genome
ATGGATGCGATTTTTTTAAAGCTCGACAATATCAAAGGCGAAAGCCAGGTTGAAGGCTTTGAAGATCAGA
TAGAGATCATGTCTTATAGCCACAATGTGGCAATGCAGGTAAATAACGATGTTAGCCTCACTGAGCGGAC
TTCCGGGCGCGCGCATGTTGGTGAAATGTCGCTCACCAAATTTGTCGACCTCGCCACGCCTGTGCTCAAT
GAGTACTGCTGTAGCGGGAGGCTAATTAGAACCGCGGTGCTGACGTTGTGCCGCAATGACGACGGCAAAA
TGCGGTCGCTTATCGTTTATACCCTGACAAACGTGCTGATATCACAACTCAGTGTTAGCGGCGGCGCCGG
CGGTAAGCCGGTGGAAACGATGTCGCTGAACTTCACGAAAATCGAATGGCAAATCACTGCCGAGAAATCA
GACGGCGCTCAGCAGGAGTCCAGAACGTCAGTATGGGATCTGGCGATGGACCAGATAGGGAAATGA