SecReT6
Effector Protein ID: 529236520
idrA
SecReT6 ID838
T6SS typeA1
Gene symbolidrA
Locus tagBB2000_0822
StrainProteus mirabilis BB2000
Repliconchromosome [GenBank: NC_022000] [Browse all T6SS(s) in this replicon]
Location [Strand]940506..941024 [+]
ProductIdrA
Effector typeProtein
Homologous effectoridrA
DescriptionHcp protein
UniProt IDS5TYW9
KEGG IDpmib:BB2000_0822
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-37, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|529236520|ref|YP_008397379.1| IdrA [Proteus mirabilis BB2000]
MPTPCYISIEGKTQGNITAGAFTADSVGNIYVQGHEDQMLVQEFSHVVTVPTDPQSGQPSGQRAHKPFRF
TVALNKAVPLLYNALASGEMLPKVELKWYRTSVEGKQEHFFTTTLTDATIVNIDCQMPHCQDPAKADFTQ
LIEVSLSYRKIDWEHTVAGTSGADDWRAPLEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|529235720|ref|NC_022000.1|:940506-941024 Proteus mirabilis BB2000, complete genome
ATGCCAACTCCTTGCTATATTTCCATTGAAGGAAAAACTCAGGGCAACATCACTGCAGGCGCGTTTACTG
CAGATTCTGTCGGCAACATTTATGTACAAGGTCATGAAGACCAAATGTTGGTACAAGAATTTTCTCACGT
GGTGACGGTTCCGACTGATCCGCAATCAGGCCAACCTTCTGGCCAACGTGCGCATAAACCGTTTCGTTTT
ACCGTGGCATTAAACAAAGCCGTTCCTCTGCTGTATAACGCATTGGCTTCCGGCGAAATGCTGCCAAAAG
TTGAGTTAAAATGGTATCGCACGTCTGTTGAAGGTAAACAAGAGCACTTCTTTACCACCACACTGACTGA
CGCGACGATCGTGAACATCGATTGCCAAATGCCTCATTGTCAAGATCCGGCTAAAGCCGACTTCACGCAA
CTTATCGAAGTTTCCCTCTCTTACCGCAAAATTGACTGGGAGCACACTGTTGCTGGAACGTCTGGTGCGG
ATGACTGGCGTGCGCCTCTCGAAGCGTAA

Reference
(1) Wenren LM et al. (2013). Two Independent Pathways for Self-Recognition in Proteus mirabilis Are Linked by Type VI-Dependent Export. MBio. 4(4). [PudMed:23882014] experimental
 
experimental experimental literature