SecReT6
Effector Protein ID: 529238653
SecReT6 ID838
T6SS typeA1
Gene symbolidsB
Locus tagBB2000_3003
StrainProteus mirabilis BB2000
Repliconchromosome [GenBank: NC_022000] [Browse all T6SS(s) in this replicon]
Location [Strand]3276277..3278448 [+]
ProductIdsB
Effector typeProtein
Homologous effectoridsB
DescriptionidsB; type VI secretion system Vgr family protein
UniProt IDS5U6R4
KEGG IDpmib:BB2000_3003
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.00E-56, Aligned region: 82..374
Phage_base_V [PF04717], Evalue: 2.70E-17, Aligned region: 425..505
Protein Sequence: 723 a.a.     [Download]
>gi|529238653|ref|YP_008399512.1| IdsB [Proteus mirabilis BB2000]
MSITNSKKYQRLGDKDGNSLSGDKTLTHGGGRTYAQDLALQEQHRQLIEKILSGDMQSGLVFTCQIGGLP
EETFQVTQFDLQEGISQLFTLSIQAVSPLSEIDFNDVLGMASSLTVKRDGHILRTVQGILAAAEQGNTDG
VKTWYQFVIRPEMWVMTLKQDSRIFQDTTVPHILETLLNESHIKYDKQLYHPEEHLQRAYTTQKRETMYD
FWCRLAAEEGINFWFEEGPQLFYSDRHLGMRAGISLTYNPQSDTDITDSTATTWRYVEQLCSDIRVDKDY
NQLRPSYPLSHQVTGEVHQQHEIFESYGRFEEDAQGQPFNQIRYEQSQNQRQVGSATTNCIELAPGRIFT
LSNHPSARMNTTWQVISISHHGVQPLADNSGGEGTQLSNQLSFVPSTQEWRPPYRFKPTADGDELATVVG
PPGEEIYTNEQGAVTVYFHWDRRGKPDHSASCWVRVAQGWNGDGFGFMAIPRVGQEVIISYLNNDIDKPI
ITGCTYNGRNRSPIDLPKHKTRTTFRTKTHKGDGFNELRFEDKNGDEEIYLHAQRDNNIHINHNKTQYVG
HDDSHTVANNRKHEVCHDEFIHIVNEQTVQVDVNQFEQIGKDRITRIDNSWKEVIHASHFQEIGENKQCD
IQNDYTLKAAGGIHTHTKIHTLQASETVIIKGKAGSIQLDAQGVTITGKILLKGDVSITGGAPEVVTQLE
AAVNEGLPLAEDCRAKAMKKGTA
-
Nucleotide Sequence: 2172 bp     [Download]
>gi|529235720|ref|NC_022000.1|:3276277-3278448 Proteus mirabilis BB2000, complete genome
ATGTCTATAACAAATTCAAAAAAATATCAAAGGCTGGGTGATAAGGATGGCAACTCACTGAGTGGGGATA
AGACATTAACCCATGGCGGTGGCAGAACATACGCGCAAGATCTCGCTTTACAAGAGCAACATAGACAACT
CATAGAGAAGATCTTAAGTGGCGACATGCAAAGTGGCTTAGTGTTTACTTGTCAGATTGGTGGATTACCC
GAAGAGACTTTCCAAGTCACGCAATTCGATTTACAAGAAGGGATCTCACAACTTTTCACCCTCTCCATCC
AAGCCGTCAGTCCACTCTCGGAAATTGATTTTAATGATGTGTTAGGCATGGCTTCCAGTTTGACGGTAAA
GCGAGATGGTCACATTCTGCGTACAGTACAAGGTATCTTAGCGGCGGCAGAGCAAGGGAATACCGATGGG
GTAAAAACCTGGTATCAATTTGTGATACGTCCTGAAATGTGGGTAATGACCCTCAAACAAGATAGTCGTA
TTTTTCAAGATACCACCGTTCCTCATATTCTTGAGACATTACTCAATGAGTCTCACATTAAATATGATAA
ACAGCTTTATCACCCAGAAGAGCATTTGCAGCGCGCCTACACCACTCAAAAACGAGAAACAATGTATGAC
TTTTGGTGCCGTTTAGCCGCAGAAGAAGGGATTAATTTTTGGTTTGAAGAGGGCCCACAGTTATTTTATA
GCGACCGACATTTGGGCATGAGAGCGGGGATATCCTTAACCTATAACCCACAATCGGATACAGATATCAC
CGATAGCACCGCCACAACGTGGCGCTATGTTGAACAACTCTGTAGCGATATTCGCGTTGATAAAGATTAC
AATCAACTTAGACCTTCCTACCCCTTAAGCCATCAAGTCACAGGAGAGGTTCATCAACAACATGAAATAT
TTGAAAGTTATGGACGCTTTGAAGAAGATGCTCAGGGACAACCCTTTAATCAGATACGTTATGAACAATC
ACAAAATCAGCGTCAAGTAGGCTCTGCGACCACAAACTGCATTGAATTAGCGCCGGGGCGTATTTTTACC
TTGTCTAACCACCCCAGTGCACGCATGAACACCACATGGCAGGTGATTAGTATCTCACATCACGGTGTGC
AACCTCTTGCCGACAACAGTGGCGGTGAAGGAACGCAATTGAGTAATCAGCTTTCCTTTGTGCCGAGTAC
TCAAGAGTGGCGCCCGCCTTACCGTTTTAAACCTACCGCCGATGGTGATGAATTAGCCACTGTCGTCGGC
CCGCCGGGCGAAGAAATCTATACCAATGAGCAAGGTGCCGTTACGGTCTATTTTCATTGGGATAGGCGTG
GTAAACCAGACCATAGCGCATCATGCTGGGTAAGAGTCGCTCAAGGTTGGAATGGGGACGGGTTTGGCTT
TATGGCTATTCCTCGTGTTGGGCAAGAAGTGATTATCTCTTATTTAAACAATGATATAGATAAACCGATT
ATCACCGGATGTACCTATAATGGTCGCAATCGTTCCCCCATTGATTTACCTAAACATAAAACCCGTACCA
CATTTCGCACCAAAACCCATAAAGGTGATGGCTTTAATGAATTGCGCTTTGAGGATAAAAATGGCGATGA
GGAAATTTATCTTCATGCGCAACGCGATAATAATATTCATATTAATCATAATAAAACCCAATACGTTGGG
CATGATGATAGCCATACTGTCGCCAATAACCGTAAGCATGAAGTGTGTCATGACGAATTTATCCACATCG
TCAATGAGCAAACAGTACAGGTTGATGTCAATCAATTTGAACAAATAGGGAAAGACCGTATCACACGCAT
TGACAATAGTTGGAAAGAAGTTATCCACGCTAGTCACTTTCAGGAAATCGGGGAAAACAAGCAGTGTGAT
ATCCAAAATGATTATACCCTGAAAGCCGCAGGGGGTATCCATACCCATACCAAAATCCACACCTTGCAAG
CCAGTGAAACGGTCATTATCAAAGGCAAGGCTGGGTCGATTCAATTGGATGCACAAGGTGTGACTATTAC
AGGTAAAATTCTGCTCAAAGGCGATGTGTCAATAACGGGGGGCGCCCCAGAAGTGGTTACTCAGTTAGAA
GCGGCGGTTAATGAAGGGTTACCATTAGCTGAGGATTGCCGTGCGAAAGCGATGAAAAAAGGAACGGCCT
AA

Reference
(1) Wenren LM et al. (2013). Two Independent Pathways for Self-Recognition in Proteus mirabilis Are Linked by Type VI-Dependent Export. MBio. 4(4). [PudMed:23882014] experimental
 
experimental experimental literature