SecReT6
Effector Protein ID: 529987976
-
SecReT6 ID805
T6SS typeA2
Gene symbol-
Locus tagKPR_2383
StrainKlebsiella pneumoniae subsp. rhinoscleromatis strain SB3432
Repliconchromosome [GenBank: NC_021232] [Browse all T6SS(s) in this replicon]
Location [Strand]2481017..2481508 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.00E-38, Aligned region: 11..152
Protein Sequence: 163 a.a.     [Download]
>gi|529987976|ref|YP_007991362.1| unnamed protein product [Klebsiella pneumoniae]
MESNSMAIPVYLWLKDDGGADIKGSVDVQDREGSIEVVAQEHNLYIPTDNNTGKLTGTRIHTPFLFTKEI
DSSSPYLYKAVTTGQTLKSAEFKWYRINDAGQEVEYFNIKLENVKVVKVNPLMHDIKNPAYEKHNHLEQI
ELRYEKITWTYKDGNIIHSDSWN
-
Nucleotide Sequence: 492 bp     [Download]
>gi|529985600|ref|NC_021232.1|:2481017-2481508 Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome
ATGGCAATTCCTGTTTATCTTTGGCTGAAAGACGACGGCGGCGCGGACATTAAAGGGTCTGTCGACGTTC
AGGATCGTGAAGGCAGTATCGAAGTGGTGGCTCAGGAGCATAACCTGTACATCCCGACCGATAACAACAC
CGGCAAACTGACCGGCACGCGTATTCATACGCCGTTCCTGTTCACCAAGGAGATCGACTCCTCCAGCCCC
TACCTGTACAAGGCGGTGACCACCGGCCAGACCCTGAAATCCGCCGAGTTCAAGTGGTACCGAATCAACG
ATGCCGGCCAGGAAGTGGAGTATTTCAATATCAAACTTGAGAACGTCAAGGTGGTGAAAGTGAATCCCCT
GATGCACGACATCAAAAACCCCGCCTACGAGAAGCACAACCATCTGGAACAGATTGAGCTGCGCTACGAG
AAGATCACCTGGACCTATAAAGACGGCAACATCATTCACTCCGATAGCTGGAACGAACGCGCCACCGCGT
AA