SecReT6
Effector Protein ID: 53721554
-
SecReT6 ID74
T6SS typeA3
Gene symbol-
Locus tagBPSS0518
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]705288..705815 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorYPK_3563
DescriptionHcp protein
UniProt IDQ63MY0
KEGG IDbps:BPSS0518
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-32, Aligned region: 9..150
Protein Sequence: 175 a.a.     [Download]
>gi|53721554|ref|YP_110539.1| unnamed protein product [Burkholderia pseudomallei K96243]
MANALVDYFLQIDGVEGESTDQQYPGLIQIQSWQWAEENSGRWGFGSGGGAGKVEMKDFEFRMVSNKASP
KLFLMCATGEHIQNAKLICRKSGKGQQEFLTISFASGLVSSFRTLGNMPISQLGHASGEVDGVLPTDQIR
INFAQIEFEYREQRNDGTMGAVIKAGYDLKQNAPI
-
Nucleotide Sequence: 528 bp     [Download]
>gi|53721039|ref|NC_006351.1|:705288-705815 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGGCAAATGCTTTGGTTGATTACTTCTTGCAGATCGATGGCGTCGAGGGTGAGTCGACCGATCAGCAAT
ATCCCGGTCTGATCCAGATCCAGAGCTGGCAGTGGGCGGAAGAGAACTCGGGCCGCTGGGGCTTCGGCAG
CGGCGGCGGCGCGGGCAAGGTCGAGATGAAGGACTTCGAGTTCCGCATGGTGTCGAACAAGGCGTCGCCG
AAGCTGTTCCTGATGTGCGCGACGGGTGAGCACATCCAGAACGCGAAGCTGATCTGCCGCAAGTCGGGCA
AGGGCCAGCAGGAGTTCCTGACGATCTCGTTCGCGAGCGGCCTCGTGTCGTCGTTCCGCACGCTCGGCAA
CATGCCGATCTCGCAGCTCGGTCACGCGAGCGGCGAAGTCGACGGCGTGCTGCCGACGGATCAGATCCGC
ATCAACTTCGCCCAGATCGAGTTCGAGTACCGCGAGCAGCGCAACGACGGCACGATGGGCGCCGTGATCA
AGGCGGGCTACGACCTGAAGCAGAACGCGCCGATCTAA