SecReT6
Effector Protein ID: 53725110
-
SecReT6 ID67
T6SS typeN/A
Gene symbol-
Locus tagBMA0855
StrainBurkholderia mallei ATCC 23344
Repliconchromosome I [GenBank: NC_006348] [Browse all T6SS(s) in this replicon]
Location [Strand]893967..896774 [+]
ProductRhs element Vgr protein
Effector typeProtein
Homologous effectorBTH_I2705
Descriptiontype VI secretion system Vgr family protein
UniProt IDQ62L24
KEGG IDbma:BMA0855
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.80E-46, Aligned region: 37..356
DUF2345 [PF10106], Evalue: 2.40E-44, Aligned region: 742..903
T6SS_Vgr [PF13296], Evalue: 5.40E-32, Aligned region: 579..687
Phage_base_V [PF04717], Evalue: 1.40E-18, Aligned region: 158..184
Phage_base_V [PF04717], Evalue: 1.40E-18, Aligned region: 423..520
Protein Sequence: 935 a.a.     [Download]
>gi|53725110|ref|YP_102595.1| Rhs element Vgr protein [Burkholderia mallei ATCC 23344]
MSVITQFTSLFSAANCLYCLDGPGEIASLQIERWVGRETLSENFQWDVYALATDPGLDLDAMLGQRVTIR
TALANGTSAVRSGLVAQAECIGYDAGLARYCLQLVPWLAALAHGRDERTFVRQGVADVLGAVFAPYGAIA
RWRFTADANQRIAELGARDYRVQYRTHTHFDFVRHVLAEAGLGFCFVEEADAPAGHTMLIFDDSTQLPED
ETSARMGGVPQRLSGTATEPDDVIVGIGQSLSLTADRVTLISSDYRGNQSTSATASLGNPAGSRELYDDV
GPEAFDSLREADAAARRHADAIVSAARFWTGYGTLRTARAGRALRIAGATWRMSRGGAPAPDAFVLTRVD
QIGINNLPATVMERVERSLGPLPPANLDARVLAQAKAGGYANRFDAAPRDQAWRPTLEDGTGQRLNPVPT
ALGAQTAIVVGPQGETRPGSTGPVHTDAQGRLRLRYHWQADGDAGTYPTRAMQRLASEGHGLQQTPRIGH
EVLVQFVNGLVHRPIVLGGLFNGRGEGGEAPTLGGEAGQPLDESVYAQASDHAASAQGNLAGGHSPAWHG
AGGGAKRHDHAGALSGFKSQEFDGQGYNQLVADDTDRMGRMQMATTHAATQLNIGHLRHQADNYLGSFRG
QGVELRSDAYGALRGARGVLISSYAPTGPSQPAGDASALQSLLAQQAALAKLLDKSADTHKTLPFAAQRG
AQRAGQSSMNGDAAPLDALGKSFATTVGADGYAQASADASRRATDNALPHTGDAVLGVEAKGGQGLLAGQ
SLQWAAGETLTIGSGNDTNLAVNRTLRVHSGQGIGWLAGANGANGAQGVGMSVIAGKDDLALQAQHDLMA
LRARDDLRVASIGADVEIAAKQTVRLAVSGGAHLTIEGGNVTFGCPGSLVVHAAQHTFVGPDQLAPALPQ
FPEKVCVECLKHAMQSGSALAGKAI
-
Nucleotide Sequence: 2808 bp     [Download]
>gi|53723370|ref|NC_006348.1|:893967-896774 Burkholderia mallei ATCC 23344 chromosome 1, complete sequence
ATGAGCGTGATCACGCAATTCACGTCGCTTTTCAGCGCTGCCAATTGTCTCTATTGTCTCGACGGTCCGG
GCGAAATCGCGTCGCTGCAGATCGAGCGCTGGGTGGGGCGGGAGACGCTCTCCGAGAACTTCCAGTGGGA
TGTCTACGCGCTCGCGACCGATCCCGGCCTCGACCTCGACGCGATGCTCGGGCAGCGCGTGACGATCCGC
ACGGCGCTCGCGAACGGCACGAGCGCCGTGCGCAGCGGGCTCGTGGCGCAGGCCGAGTGCATCGGCTACG
ACGCCGGCCTCGCGCGCTACTGCCTGCAGCTCGTGCCGTGGCTCGCCGCGCTCGCGCACGGCCGCGACGA
GCGCACGTTCGTGCGGCAGGGCGTCGCCGACGTGCTCGGCGCGGTGTTCGCGCCGTACGGCGCGATCGCC
CGCTGGCGCTTCACCGCGGACGCGAACCAGCGCATCGCGGAACTCGGCGCGCGCGACTACCGCGTGCAGT
ACCGCACCCACACGCATTTCGATTTCGTCCGGCACGTGCTTGCCGAAGCGGGTCTCGGCTTTTGCTTCGT
CGAGGAGGCGGACGCGCCCGCGGGCCACACGATGCTGATCTTCGACGACAGCACGCAGTTGCCCGAGGAC
GAGACTTCCGCGCGCATGGGCGGCGTGCCGCAGCGGCTGAGCGGCACGGCGACCGAGCCGGACGACGTGA
TCGTCGGCATCGGGCAGTCGCTGTCGCTGACCGCGGATCGCGTCACGCTGATCAGCAGCGACTACCGCGG
CAACCAGTCGACGAGCGCGACGGCGAGCCTCGGCAATCCGGCCGGATCGCGCGAGCTGTACGACGACGTC
GGGCCGGAGGCGTTCGACAGCCTGCGCGAGGCCGACGCCGCCGCGCGGCGGCACGCGGACGCGATCGTCT
CGGCGGCGCGCTTCTGGACAGGCTACGGCACGTTGCGCACCGCGCGCGCTGGCCGCGCGCTGCGCATCGC
GGGCGCGACGTGGCGCATGTCGCGCGGCGGCGCGCCGGCGCCCGATGCGTTCGTGTTGACGCGCGTCGAT
CAGATCGGCATCAACAATTTGCCCGCGACGGTGATGGAGCGCGTCGAGCGCAGCCTCGGCCCGCTGCCGC
CCGCGAATCTCGACGCGCGCGTGCTCGCGCAGGCGAAGGCGGGCGGCTATGCGAACCGGTTCGACGCCGC
GCCGCGCGACCAGGCATGGCGCCCGACGCTGGAGGACGGCACCGGCCAGCGACTGAACCCGGTGCCGACG
GCGCTCGGCGCGCAGACGGCGATCGTCGTCGGGCCGCAGGGCGAGACGCGGCCGGGCTCGACGGGCCCGG
TGCATACCGACGCGCAGGGCCGGTTGCGGCTGCGCTATCACTGGCAGGCGGACGGCGACGCGGGCACCTA
TCCGACGCGCGCGATGCAGCGGCTCGCGAGCGAGGGGCACGGGCTGCAGCAGACGCCGCGGATCGGCCAC
GAGGTGCTCGTGCAGTTCGTCAACGGCCTCGTGCACCGGCCGATCGTGCTCGGCGGGCTGTTCAACGGCC
GCGGCGAGGGCGGCGAAGCGCCGACGCTCGGCGGCGAAGCGGGGCAGCCGCTCGACGAATCGGTCTACGC
ACAGGCGAGCGACCACGCGGCGAGCGCGCAAGGCAATCTTGCGGGCGGCCATAGCCCCGCGTGGCACGGC
GCGGGCGGCGGCGCGAAGCGCCACGATCACGCGGGCGCGCTGTCCGGCTTCAAGAGCCAGGAGTTCGACG
GCCAGGGCTACAACCAGCTCGTCGCGGACGATACCGATCGCATGGGCCGCATGCAGATGGCGACGACGCA
CGCGGCGACCCAGCTCAATATCGGCCATTTGCGGCATCAGGCCGACAACTATCTCGGCAGCTTCCGCGGG
CAAGGCGTCGAGCTGCGCTCGGACGCGTACGGCGCGCTGCGCGGCGCGCGCGGCGTGCTGATCTCCAGCT
ATGCGCCGACGGGGCCGTCGCAGCCGGCGGGCGATGCGTCGGCGCTGCAGTCGCTGCTCGCGCAACAGGC
GGCGCTCGCGAAGCTTCTCGACAAATCGGCGGACACGCACAAGACCTTGCCGTTCGCCGCGCAGCGTGGC
GCGCAGCGGGCCGGACAGTCGTCGATGAACGGCGACGCCGCGCCGCTCGACGCGCTCGGGAAGAGTTTCG
CGACGACGGTCGGCGCCGACGGCTACGCGCAGGCGTCGGCCGACGCATCGCGCCGCGCGACGGACAATGC
GCTGCCGCATACCGGCGACGCGGTGCTCGGCGTCGAGGCGAAGGGCGGCCAGGGGCTGCTGGCCGGCCAG
TCGCTGCAATGGGCGGCGGGCGAGACGCTGACCATCGGCAGCGGCAACGACACCAACCTCGCGGTCAACC
GGACGTTGCGCGTGCACAGCGGGCAGGGCATCGGCTGGCTTGCCGGCGCGAACGGCGCGAACGGCGCGCA
GGGCGTCGGCATGAGCGTGATCGCCGGCAAGGACGATCTGGCGCTGCAGGCGCAGCACGACCTGATGGCG
CTGCGCGCGCGCGACGATCTGAGGGTCGCGTCGATCGGCGCGGACGTCGAGATCGCGGCGAAGCAGACCG
TGCGGCTCGCGGTCAGCGGCGGCGCGCATCTGACGATCGAAGGCGGCAACGTCACGTTCGGCTGCCCGGG
CTCGCTCGTCGTTCATGCGGCCCAGCATACGTTCGTCGGGCCGGATCAACTGGCTCCCGCGCTGCCGCAG
TTTCCCGAGAAGGTGTGCGTCGAATGCCTGAAGCACGCGATGCAATCGGGCAGCGCACTGGCCGGCAAGG
CGATCTGA