SecReT6
Effector Protein ID: 541869767
-
SecReT6 ID847
T6SS typeA1
Gene symbol-
Locus tagM892_10090
StrainVibrio campbellii ATCC BAA-1116
Repliconchromosome II [GenBank: NC_022269] [Browse all T6SS(s) in this replicon]
Location [Strand]2199433..2202012 [+]
ProductS-type Pyocin family
Effector typeProtein
Homologous effectorVPA1263
DescriptionVPA1263
UniProt IDA7MTX8
KEGG IDvca:M892_10090 vha:VIBHAR_00543
PDB IDNA
Domain hit(s) vs Pfam Colicin-DNase [PF12639], Evalue: 1.00E-32, Aligned region: 727..857
Pyocin_S [PF06958], Evalue: 1.10E-30, Aligned region: 590..723
LysM [PF01476], Evalue: 3.30E-05, Aligned region: 359..403
Protein Sequence: 859 a.a.     [Download]
>gi|541869767|ref|YP_008526771.1| S-type Pyocin family [Vibrio campbellii ATCC BAA-1116]
MSHEFGLIEGNFHNLSEADVVSAIPAHLTFEQLKQHLHEGKLVLVSDTPQIPALLSYNDPIGPKTWRLNS
EVISAFSDDATKELLAKTKIPRVTGGYSTRIVETATLERAYTPQPIATESEEEITKEFEYSFEVGCSDAT
IKKMVHSDFALAKTEKENAVTRWEQTKTEQGTRYTALCVFDEPKRLNIHIADDNLGLTPLEAITLQKAGS
HKTEEGFIPVVPAVRLGERLGLPTEGYYYHLNDGELVQEYKILGQEKWAFYATRSTQDKLNDERGFTKDQ
SAILVYWKLANQVLENQYIIYLERQITREELDNLSEDWLSENGIKLDIPALFDVAKQPEEARVEDNNDET
EAEQTAATHIVVAGETWQSIAERYGMGAKALLSLNPVFEADPLSLTIGDEIVVAEAQQKQTPDKKNTFPP
LRPQTYNNIRNSHYQHSDPLLGLTKYRAINAADFVEGDVAILNLKDATSSLVFAKSCTRPEGCIEIGDQQ
ESISNFGPWSFFFAQANATPAAVIPAIQATQAQMAMGSSAAVAGSPEQTQQTQTAAMQLDKLAGTLKDKI
VEGYRWQVEGIGALFAMQQNLFGDNTQYTDQDLRQVTTAQSRVRVHITEPQDGEFYPHVQGYHVDDTRIP
IKYVKQGNNGQLSVAIEDNGPTIYWTPEENGEASWQTTPDHSDDFEKEDILVTPIHSDGDANVTVTPAPE
EKDWRDAILVFPESSGIAPLYVVYKESPRDKPGVVTGKGEDIFGIWLAGAGKDLGAPIPSQIADKLRGKE
FSSFDAFRKAFWLEVSKDSDLKGQFNAQNQIRIGLGKAPKARSRDKVGKRKSFELHHVDEVQNGGKVYDL
DNLKVTTPKNHIDIHRGMK
-
Nucleotide Sequence: 2580 bp     [Download]
>gi|541866813|ref|NC_022269.1|:2199433-2202012 Vibrio campbellii ATCC BAA-1116 chromosome I, complete sequence
ATGTCCCATGAATTCGGGTTGATAGAGGGCAACTTCCACAACCTTTCGGAAGCAGATGTCGTCTCTGCTA
TTCCTGCTCATCTTACCTTTGAGCAGCTAAAACAACACCTCCACGAGGGTAAGCTCGTACTTGTGAGTGA
TACACCTCAAATTCCCGCACTTCTGAGTTACAACGACCCAATTGGTCCTAAAACATGGCGCCTAAACTCT
GAGGTTATCTCTGCATTTTCGGATGATGCGACTAAGGAGTTGTTAGCAAAGACTAAAATCCCCAGAGTAA
CGGGAGGGTACAGCACACGTATTGTAGAGACCGCGACACTCGAACGAGCTTACACGCCGCAGCCAATAGC
AACCGAAAGTGAAGAGGAAATCACCAAGGAATTCGAGTACAGCTTCGAAGTTGGCTGCTCGGATGCCACC
ATAAAGAAAATGGTGCACAGTGACTTTGCTTTAGCGAAAACTGAAAAAGAGAACGCGGTGACTCGCTGGG
AACAAACCAAAACCGAGCAAGGCACCCGCTACACAGCGTTATGTGTGTTTGATGAGCCAAAGCGTTTAAA
TATCCATATTGCTGATGACAACCTCGGGCTGACACCACTTGAAGCCATCACACTACAAAAAGCTGGCAGC
CATAAAACTGAGGAAGGTTTTATACCTGTTGTTCCGGCTGTGCGATTGGGCGAACGCCTAGGCTTGCCGA
CAGAAGGCTATTACTACCACTTAAATGATGGTGAACTGGTCCAAGAGTACAAAATTCTCGGACAAGAAAA
ATGGGCGTTTTACGCTACGCGATCGACACAAGACAAGCTCAATGATGAGCGTGGTTTTACCAAAGACCAA
AGCGCTATATTGGTGTATTGGAAGTTGGCCAACCAAGTCCTTGAGAACCAATACATCATTTATCTTGAGC
GCCAAATCACACGAGAAGAGCTCGATAACCTCAGTGAAGATTGGCTGAGTGAAAACGGGATAAAGTTGGA
TATTCCTGCACTGTTTGATGTAGCTAAACAGCCGGAAGAAGCACGCGTAGAAGATAACAACGATGAGACG
GAAGCAGAACAAACCGCAGCAACGCACATCGTAGTTGCAGGGGAAACCTGGCAGAGCATCGCTGAACGGT
ATGGTATGGGAGCGAAAGCCTTGCTCTCGCTTAACCCAGTGTTTGAGGCCGACCCTCTATCACTCACAAT
TGGTGATGAAATTGTTGTTGCAGAAGCACAGCAAAAACAAACACCGGACAAAAAGAACACTTTTCCGCCT
CTGCGCCCGCAAACCTACAACAACATCCGCAACAGTCATTACCAACACAGCGATCCATTGCTTGGGTTGA
CCAAATACCGAGCCATCAACGCCGCTGATTTCGTCGAAGGTGATGTCGCCATCCTTAACTTAAAAGACGC
CACAAGCTCGCTCGTGTTCGCTAAATCCTGCACCAGGCCAGAAGGGTGTATTGAAATTGGTGACCAACAA
GAGTCAATCAGTAACTTCGGGCCTTGGTCATTCTTTTTTGCACAAGCGAATGCGACCCCAGCAGCTGTCA
TACCCGCCATTCAAGCAACACAAGCACAAATGGCCATGGGAAGTTCCGCAGCTGTCGCCGGCTCACCAGA
GCAAACGCAGCAAACCCAAACTGCGGCGATGCAGTTGGATAAACTGGCAGGAACATTGAAAGACAAAATC
GTTGAGGGCTACCGCTGGCAAGTAGAAGGCATTGGCGCCTTGTTTGCCATGCAGCAAAACTTATTTGGCG
ATAACACCCAATACACAGACCAAGATTTGCGCCAAGTGACCACGGCGCAAAGCCGCGTTCGTGTCCACAT
TACCGAGCCCCAAGATGGAGAGTTTTACCCGCACGTGCAGGGCTATCATGTAGACGACACGCGTATCCCC
ATCAAATACGTGAAACAGGGAAATAATGGCCAACTGTCCGTTGCGATTGAAGATAACGGACCAACCATCT
ATTGGACACCAGAAGAAAACGGTGAAGCAAGTTGGCAAACTACTCCCGATCATAGTGATGACTTTGAAAA
AGAAGATATACTCGTCACGCCAATCCACTCGGATGGCGATGCGAACGTCACCGTTACGCCTGCGCCGGAA
GAGAAAGACTGGCGTGATGCGATCTTGGTATTCCCGGAAAGCTCAGGTATTGCACCGCTCTATGTGGTTT
ACAAAGAAAGCCCGAGGGATAAGCCCGGAGTCGTTACCGGGAAAGGCGAAGATATCTTTGGCATTTGGTT
GGCAGGTGCAGGTAAGGACTTAGGAGCCCCAATACCGTCTCAAATTGCAGATAAGCTGAGAGGAAAAGAA
TTCAGCAGCTTTGATGCGTTTCGAAAAGCATTCTGGTTAGAGGTATCTAAAGACAGCGATTTAAAGGGAC
AATTTAATGCACAAAACCAAATTCGAATCGGGTTAGGGAAGGCTCCTAAAGCAAGAAGTCGAGATAAAGT
AGGAAAGAGAAAATCTTTTGAGCTACATCATGTAGATGAAGTGCAGAATGGTGGCAAGGTTTACGATTTA
GATAATTTAAAAGTGACCACACCCAAAAATCATATTGATATTCATAGAGGTATGAAGTGA