SecReT6
Effector Protein ID: 541870625
-
SecReT6 ID847
T6SS typeA1
Gene symbol-
Locus tagM892_22365
StrainVibrio campbellii ATCC BAA-1116
Repliconchromosome II [GenBank: NC_022270] [Browse all T6SS(s) in this replicon]
Location [Strand]1011098..1011616 [+]
ProductT6SS/hemolysin co-regulated protein Hcp
Effector typeProtein
Homologous effectorVEPGS_0021
DescriptionVEPGS_0021
UniProt IDT2ALB8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.80E-36, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|541870625|ref|YP_008529029.1| T6SS/hemolysin co-regulated protein Hcp [Vibrio campbellii ATCC BAA-1116]
MPTPAYMSIKGETQGHITKDTYSADSVGNTWQEAHVDEFLVQELDHVLTVPRDPQSGQPTGQRVHRPLVV
TKVQDRCSPLLFNALVSGEKLPECVIRFYRTSVQGKQEHYYSIKLIDALLVDIQTRMNHCQDAATADRVT
EEVLKLTYRAIEVTHENCGTAGNDDWRAPREA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|541870142|ref|NC_022270.1|:1011098-1011616 Vibrio campbellii ATCC BAA-1116 chromosome II, complete sequence
ATGCCAACTCCAGCATATATGTCTATCAAAGGTGAAACTCAAGGTCACATCACTAAAGATACTTACTCTG
CAGATTCTGTAGGTAACACATGGCAAGAAGCTCACGTTGATGAGTTCCTAGTTCAAGAACTAGACCACGT
ACTAACAGTACCACGTGACCCACAAAGTGGTCAGCCTACTGGTCAACGTGTTCACCGTCCACTTGTTGTA
ACTAAAGTTCAAGACCGTTGTTCTCCACTACTATTCAACGCACTAGTATCTGGCGAAAAACTTCCTGAGT
GTGTGATCCGTTTCTACCGTACTTCAGTTCAAGGTAAGCAAGAGCACTACTACTCAATCAAACTGATTGA
TGCACTACTAGTAGACATCCAAACTCGCATGAACCACTGTCAAGACGCTGCAACAGCAGACCGCGTGACA
GAAGAAGTTCTTAAGCTGACTTACCGTGCAATCGAAGTAACTCACGAAAACTGTGGTACAGCTGGTAACG
ACGACTGGCGTGCTCCACGCGAAGCATAA