SecReT6
Effector Protein ID: 541871691
-
SecReT6 ID847
T6SS typeA1
Gene symbol-
Locus tagM892_22335
StrainVibrio campbellii ATCC BAA-1116
Repliconchromosome II [GenBank: NC_022270] [Browse all T6SS(s) in this replicon]
Location [Strand]998499..1000097 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorVP1388
DescriptionVP1388
UniProt IDT2AR69
KEGG IDvca:M892_22335
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 532 a.a.     [Download]
>gi|541871691|ref|YP_008529023.1| hypothetical protein M892_22335 [Vibrio campbellii ATCC BAA-1116]
MRNSENILRNLPKELAQKISISAKKSSAGLLTAIRNELGNGNWVALSSFSRRTPLTDAQLQSFPRLKAQL
ESVSSTGESKVYKAGYKQVTDDVTLVRSYAHVPYEPSPEHKIVVEFAGQWSSNAACLMLGKTDAQKEKVT
VSKADTENKHRSLATFKDLDAEGKTLYIKIPCSDQPQPILLKLAEDLQPVDKETQMDEWDNVLVPVRPLA
YLDGSNDKAKASDLRGGFLYVFWKGKLWREMAINEKGYYQDVDVEYYRTLEQEEKKKDTPQVIQRSASGF
AMAHFWAPYKISGEVQQGENGLKFIFSPKQKRFAQIEALESDAALLEKSSTPLDELSSYSDAQSFSSQEF
TSDVDSAAIHKVTEDDMPWLSDQQAIVRSYDQSNTVIAYVDGKNSGFLVRLEVGLADGPLAEQLDPYSLA
SYDGLVAIMEDSESDWRVTEPFELISKDGYISALVTGMPPKGKFTLVLSHLGGQDSEVMMFEGLTYQEIT
AEPPELPMASKHEEQRVPDEVNEERERQKKTLDMMLELINAN
-
Nucleotide Sequence: 1599 bp     [Download]
>gi|541870142|ref|NC_022270.1|:998499-1000097 Vibrio campbellii ATCC BAA-1116 chromosome II, complete sequence
GTGCGAAATTCAGAAAATATTCTCAGAAACCTGCCTAAAGAGCTTGCTCAGAAGATCTCAATCTCTGCCA
AAAAGTCTAGCGCCGGCTTGCTAACGGCTATTCGAAATGAGCTAGGAAATGGTAACTGGGTGGCGTTGTC
TTCCTTCTCTCGTAGAACGCCGTTAACGGATGCTCAATTACAAAGTTTCCCAAGACTAAAAGCACAGCTT
GAATCTGTCTCATCGACTGGTGAGAGTAAAGTTTATAAAGCAGGTTATAAGCAGGTAACGGACGATGTGA
CATTGGTTCGCAGTTACGCGCATGTGCCTTATGAACCAAGTCCAGAACATAAAATCGTTGTCGAGTTTGC
TGGGCAGTGGTCTAGCAATGCAGCCTGTTTGATGTTGGGAAAAACCGACGCACAAAAAGAAAAAGTGACT
GTAAGTAAGGCTGATACCGAGAACAAACACCGCAGCCTTGCCACGTTTAAAGATCTGGATGCTGAAGGCA
AAACGCTTTATATCAAAATCCCTTGTTCCGACCAGCCTCAGCCAATCTTGCTTAAACTCGCTGAAGACCT
GCAACCAGTCGATAAAGAAACTCAGATGGATGAGTGGGATAACGTGTTGGTGCCGGTCAGACCTTTGGCT
TACTTAGATGGTAGCAACGACAAAGCAAAAGCTTCTGACCTGCGTGGTGGTTTCCTTTATGTGTTTTGGA
AAGGAAAGCTTTGGCGAGAGATGGCGATAAACGAGAAAGGTTACTACCAAGATGTTGACGTCGAGTATTA
CCGCACGCTAGAGCAAGAAGAAAAGAAAAAAGACACACCTCAGGTAATACAAAGAAGCGCAAGCGGTTTT
GCTATGGCGCATTTCTGGGCACCTTACAAAATATCGGGTGAAGTCCAACAGGGAGAAAATGGACTCAAGT
TCATTTTCTCACCAAAGCAAAAGCGCTTTGCTCAAATTGAAGCATTAGAATCAGATGCTGCTTTGCTTGA
GAAATCCAGCACACCATTAGATGAATTAAGCAGTTACAGTGACGCACAGTCATTCAGTTCACAAGAATTC
ACCTCCGATGTAGACAGTGCCGCCATCCACAAAGTTACCGAAGACGACATGCCATGGCTGAGTGACCAAC
AAGCCATCGTTCGCAGTTATGACCAGAGTAATACGGTCATTGCTTATGTGGATGGCAAAAACAGTGGTTT
TCTTGTCCGTTTGGAAGTTGGCTTGGCAGATGGCCCATTGGCAGAACAGCTAGACCCTTACTCGTTGGCT
TCGTATGACGGCTTGGTTGCCATTATGGAGGATTCTGAAAGTGACTGGCGAGTGACCGAGCCCTTTGAGT
TAATCAGTAAGGATGGTTATATCAGTGCCTTAGTGACAGGTATGCCTCCCAAAGGAAAGTTTACACTTGT
GCTTTCGCACCTTGGGGGGCAAGACAGCGAGGTGATGATGTTTGAAGGGCTGACGTACCAAGAGATCACC
GCAGAACCACCAGAATTACCGATGGCTTCTAAGCACGAAGAACAGCGAGTGCCTGATGAAGTTAATGAAG
AAAGAGAGCGTCAAAAGAAGACATTAGACATGATGCTAGAGCTTATCAACGCCAATTAA