SecReT6
Effector Protein ID: 54307877
SecReT6 ID78
T6SS typeA5
Gene symbol-
Locus tagPBPRA0674
StrainPhotobacterium profundum SS9
Repliconchromosome I [GenBank: NC_006370] [Browse all T6SS(s) in this replicon]
Location [Strand]743312..743791 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorVPA1027
DescriptionHcp protein
UniProt IDQ6LUD0
KEGG IDppr:PBPRA0674
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.40E-30, Aligned region: 6..134
Protein Sequence: 159 a.a.     [Download]
>gi|54307877|ref|YP_128897.1| hypothetical protein PBPRA0674 [Photobacterium profundum SS9]
MQANTYLKYGDIKGETTAKDYEGMITLLSVDWGVGREITSFTGTAQDREASSTRLHDMTITKLQDKASTY
LFKEATIGKGTDIQFYVTRQGDKVEEILKLELTDAMIANFNVVVNDDRPTETITISYTEMVMTVTPTDDD
NNLEPKVVWGYSGVTGQKK
-
Nucleotide Sequence: 480 bp     [Download]
>gi|54307237|ref|NC_006370.1|:743312-743791 Photobacterium profundum SS9 chromosome 1, complete genome
ATGCAAGCTAATACTTACCTGAAATATGGTGATATTAAGGGTGAAACTACAGCTAAAGATTATGAAGGGA
TGATTACACTGCTCTCTGTTGATTGGGGAGTCGGTCGTGAAATTACTTCATTCACGGGTACAGCACAAGA
TCGTGAAGCGAGTTCTACACGTCTTCATGATATGACCATCACTAAGCTTCAAGACAAAGCCTCAACGTAT
TTATTTAAAGAAGCAACCATTGGTAAAGGAACAGACATTCAGTTCTATGTGACCAGGCAAGGTGATAAAG
TTGAAGAAATTCTGAAGCTTGAACTAACAGATGCAATGATTGCCAATTTTAACGTTGTTGTTAATGATGA
TCGTCCAACTGAAACAATTACCATTTCTTACACTGAAATGGTAATGACGGTAACACCTACCGATGATGAT
AATAACCTTGAGCCTAAGGTTGTTTGGGGTTACAGCGGCGTTACTGGTCAGAAAAAATAA