SecReT6
Effector Protein ID: 543441460
-
SecReT6 ID945
T6SS type
Gene symbol-
Locus tagVPR01S_11_01570
Strain
RepliconT6SS [GenBank: BATJ01000011] [Browse all T6SS(s) in this replicon]
Location [Strand]161248..163059 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorVPR01S_11_01570
DescriptionMIX‐effector Vpr01570 that contains a CNF1 toxin domain witch are deamidases that target MIX‐effector Vpr01570 that contains a CNF1 toxin domain and set out to monitor its functionality. CNF1 toxins are deamidases that target and activate Rho GTPases.
UniProt IDU3BNK6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CNF1 [PF05785], Evalue: 2.0e-20, Aligned region: 347..588
Protein Sequence: 603 a.a.     [Download]
>gi|543441460|ref|GAD68163.1| hypothetical protein [Vibrio proteolyticus NBRC 13287]
MPNTKKTAARFVAAYYPPVETPQSKCLPTRETVREKPQPSARFQCVLRIYTAEDELSQYSVGRGQWKLLT
NTKGVAPLANWEVSSQDDGTTLLTASCHKEASRRLVYEWIRGAGYGKQYEVMTRPKGSSDINAQFVPVKL
ALLRDGVAGWPTQGYFYHFIDGALQAECQIAGEGRWSYQLLCSDERGLDERPLFERHLSHFLLPYRIENH
SPGEQYLLYRRERLSTEEWASLSSSWLAQHGLRLNMDAVIAAFNGPLTTEVRQEDIPPSGHLRVGHVYPF
GDVWGQYRHPELAPELVHIQTDSSVNQRMPVVMVGEWDGEGYSTGEQVSMTQLTGRGPFYLKTPRAPRAK
FWFSRIDQRAEFSAEKASERLSDSDQRDVLECSDGTQMTSFNKSMNAWVTHFWDDNPLPEELDVLVLHNG
YTGAAGVRIDLDELDPGQQILVTGGTLSGCTMVTGVKGRQFYALHAGTAISPNEWKTGQHGVRDNYALLK
LMMPENDLTAPPEWDNDGMPALLDCFSQATMAYSGKPEAKMQRADARCFNYYRPEILYSVCCSFSLIKKD
RHGNVSVETLTELGEISQDSSAENKSVSNFVYEARDTRVKVLL
-
Nucleotide Sequence: 1812 bp     [Download]
>gi|1062685122|ref|BATJ01000011.1|:161248-163059 Vibrio proteolyticus NBRC 13287 DNA, contig: VPR01S11, whole genome shotgun sequence
ATGCCAAATACCAAAAAAACAGCAGCCCGATTTGTCGCGGCTTATTATCCGCCGGTAGAGACACCCCAGT
CTAAATGTCTGCCAACCAGGGAGACGGTCAGAGAAAAACCTCAGCCGAGTGCTCGCTTTCAGTGCGTACT
GAGAATCTATACCGCTGAGGATGAACTGAGTCAGTACAGTGTAGGGCGAGGTCAGTGGAAACTGCTGACG
AATACAAAAGGGGTTGCGCCTTTGGCCAACTGGGAAGTGAGCTCACAAGACGACGGGACCACGTTACTGA
CCGCGTCTTGCCATAAAGAAGCCAGTCGCAGGTTAGTGTATGAGTGGATTCGAGGGGCGGGTTATGGCAA
ACAGTATGAGGTCATGACCCGCCCCAAAGGCTCGTCTGACATCAATGCACAGTTTGTTCCCGTTAAACTG
GCTTTGCTTCGTGACGGTGTCGCAGGCTGGCCAACGCAAGGCTACTTCTATCATTTTATTGATGGAGCGC
TGCAGGCTGAATGCCAGATTGCAGGCGAAGGTCGCTGGAGCTATCAGTTGCTCTGTTCGGACGAACGCGG
GCTGGATGAGCGTCCGCTGTTCGAGCGCCATCTTTCGCATTTTTTGCTGCCCTATCGAATCGAGAACCAT
TCGCCGGGTGAGCAGTATTTACTGTATCGCCGTGAACGACTTTCCACTGAAGAGTGGGCCAGCCTCTCAT
CTTCATGGTTGGCTCAGCATGGACTTCGCCTGAATATGGACGCTGTCATTGCCGCGTTCAATGGCCCGTT
GACGACAGAAGTTCGACAAGAAGATATTCCGCCAAGTGGTCACTTGCGAGTTGGCCATGTGTATCCGTTT
GGAGATGTCTGGGGCCAATATCGCCATCCAGAACTGGCTCCTGAGCTGGTGCACATTCAGACGGATTCTT
CTGTGAACCAACGTATGCCTGTCGTGATGGTGGGAGAATGGGACGGAGAGGGGTACAGCACCGGTGAGCA
GGTTTCGATGACACAATTGACCGGACGAGGGCCGTTTTACCTCAAAACGCCACGCGCACCACGAGCGAAG
TTTTGGTTTTCGCGGATTGATCAAAGGGCAGAGTTTAGCGCGGAAAAAGCCTCTGAGCGTCTCAGTGACA
GCGACCAACGGGATGTACTGGAGTGCAGTGATGGCACACAGATGACGTCGTTCAACAAATCAATGAACGC
TTGGGTGACTCATTTCTGGGATGACAATCCACTGCCCGAAGAGCTGGATGTGCTTGTGTTGCACAATGGT
TATACCGGAGCGGCAGGCGTACGCATTGACCTGGATGAACTGGATCCGGGCCAGCAAATACTTGTGACGG
GTGGAACATTGAGTGGCTGCACCATGGTCACGGGTGTCAAAGGGCGGCAGTTTTACGCCTTGCATGCCGG
GACAGCGATCTCTCCCAATGAGTGGAAAACAGGTCAGCACGGAGTGCGCGACAATTATGCACTGCTTAAA
TTGATGATGCCTGAGAACGATCTGACGGCACCGCCTGAGTGGGATAATGATGGTATGCCAGCATTACTGG
ATTGTTTTTCTCAGGCAACCATGGCCTACAGCGGAAAGCCGGAAGCCAAAATGCAGCGTGCGGACGCGCG
TTGTTTTAATTATTATCGGCCGGAAATTCTCTACAGTGTTTGTTGCTCGTTCTCACTGATCAAAAAGGAC
CGCCACGGTAACGTCAGTGTTGAGACGTTAACCGAACTGGGCGAGATCAGTCAGGACAGTTCTGCAGAGA
ATAAGAGTGTTTCTAATTTTGTTTATGAGGCGCGTGACACTCGGGTGAAAGTATTACTTTGA

Reference
(1) Ann Ray, Nika Schwartz, Marcela de Souza Santos, Junmei Zhang, Kim Orth, Dor Salomon (2017). Type VI Secretion System MIX-effectors Carry Both Antibacterial and Anti-Eukaryotic Activities. EMBO Rep.. 18(11):1978-1990. [PudMed:28912123] experimental
 
experimental experimental literature