SecReT6
Effector Protein ID: 544393084
-
SecReT6 ID851
T6SS typeA2
Gene symbol-
Locus tagLY180_14340
StrainEscherichia coli LY180
Repliconchromosome [GenBank: NC_022364] [Browse all T6SS(s) in this replicon]
Location [Strand]3012609..3013100 [+]
ProductHcp family type VI secretion system effector
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDT2G6D7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.50E-39, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|544393084|ref|YP_008565935.1| Hcp family type VI secretion system effector [Escherichia coli LY180]
MAIPAYLWLKDDGGADIKGSVDVQGREGSIEVVALDHDVYIPTDNNTGKLTGTRTHKPFTFTKEIDASSP
YLYKAVTTGQTLKTAEFKFYRINDAGQEVEYFNITLDNVKLVRVAPLMHDIKEPSKEKHNHLERIEFRYE
KITWTYKDGNIIHSDSWNERPSA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|544388862|ref|NC_022364.1|:3012609-3013100 Escherichia coli LY180, complete genome
ATGGCTATTCCTGCTTATCTCTGGCTGAAAGATGACGGCGGCGCGGATATCAAAGGTTCCGTGGACGTTC
AGGGGCGCGAAGGCAGCATCGAAGTGGTGGCGCTGGATCACGATGTGTACATCCCGACCGACAACAACAC
CGGCAAACTGACCGGTACCCGTACTCACAAGCCCTTTACGTTTACCAAAGAAATCGATGCGTCCAGCCCG
TATCTCTACAAAGCAGTCACCACCGGCCAGACCCTGAAAACGGCGGAATTTAAGTTTTACCGCATCAACG
ATGCCGGTCAGGAAGTGGAGTACTTCAACATCACGCTGGATAACGTCAAGCTGGTCAGAGTCGCTCCGCT
GATGCACGACATCAAGGAGCCTTCCAAAGAGAAGCATAACCACCTGGAACGCATTGAGTTCCGCTACGAG
AAAATCACCTGGACTTACAAAGACGGCAACATCATTCATTCCGACTCGTGGAATGAACGTCCTTCCGCCT
GA