SecReT6
Effector Protein ID: 549478371
-
SecReT6 ID854
T6SS typeA3
Gene symbol-
Locus tagIA1_01470
StrainSalmonella enterica subsp. enterica serovar Thompson str. RM6836
Repliconchromosome [GenBank: NC_022525] [Browse all T6SS(s) in this replicon]
Location [Strand]331765..332250 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorSTM0277
DescriptionTae4_TM
UniProt IDV5KEH4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF4285 [PF14113], Evalue: 1.80E-28, Aligned region: 40..141
Protein Sequence: 161 a.a.     [Download]
>gi|549478371|ref|YP_008612119.1| hypothetical protein IA1_01470 [Salmonella enterica subsp. enterica serovar Thompson str. RM6836]
MNRPSFNEAWLAFRKVNHSVADVGSIIGGNVGKNITGGYFQNACPIRMSYVLNATGFPIARNSPYAKVSG
ADNKFYIYRVNDMIDYLTHTMSKPDLIVNNPKQSDFIGKKGIIVVKGHGWSNARGHVTLWNGSICSDQCH
LLNDPDNGPFVPEVGTLWILP
-
Nucleotide Sequence: 486 bp     [Download]
>gi|549478129|ref|NC_022525.1|:331765-332250 Salmonella enterica subsp. enterica serovar Thompson str. RM6836, complete genome
ATGAACAGACCTTCATTCAATGAAGCGTGGTTAGCTTTTAGGAAGGTGAATCATTCCGTCGCTGATGTGG
GTAGCATTATTGGTGGAAACGTTGGGAAAAATATAACTGGTGGTTATTTTCAAAATGCCTGCCCTATTCG
AATGAGCTATGTTTTGAATGCGACAGGATTCCCAATAGCCCGTAACTCTCCGTATGCAAAGGTTAGTGGT
GCCGATAATAAATTCTATATTTATCGCGTGAATGATATGATTGATTATCTTACTCATACTATGAGCAAGC
CTGATCTTATTGTTAATAATCCGAAACAGAGTGACTTTATAGGGAAGAAAGGAATTATCGTAGTAAAAGG
GCATGGCTGGAGCAATGCCAGAGGACACGTTACATTATGGAATGGCAGTATCTGTTCAGATCAGTGCCAC
TTATTAAATGATCCAGATAATGGACCATTTGTTCCTGAAGTTGGGACTCTGTGGATACTGCCGTGA