SecReT6
Effector Protein ID: 549718588
hcp
SecReT6 ID856
T6SS typeA1
Gene symbolhcp
Locus tagVIBNI_B0336
StrainVibrio nigripulchritudo str. SFn1
Repliconchromosome [GenBank: NC_022543] [Browse all T6SS(s) in this replicon]
Location [Strand]367158..367676 [-]
ProductHaemolysin co-regulated protein (putative Type VI secretion system effector, Hcp1)
Effector typeProtein
Homologous effectorVCA0017
DescriptionHcp protein
UniProt IDU4KBC6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.30E-36, Aligned region: 6..155
Protein Sequence: 172 a.a.     [Download]
>gi|549718588|ref|YP_008641221.1| Haemolysin co-regulated protein (putative Type VI secretion system effector, Hcp1) [Vibrio nigripulchritudo]
MPTPCYISIEGETQGLITAGALSTDSIGDAFVEGHEDQMLVQQFDHNVTVPTDPQSGQPSGQRVHKPFKF
TVALNKAVPLLYNALASGEKMKSVELKWYRTSIEGKQENFFTTSLESASIVDIHCEMPHCQDPTNADFTQ
NVTVSLSYRKINWDHVNAGTSGSDDWRKPVEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|549718281|ref|NC_022543.1|:c367676-367158 Vibrio nigripulchritudo str. SFn1 chromosome, complete genome
ATGCCAACTCCATGTTATATCTCCATCGAAGGTGAAACACAGGGGCTAATTACCGCAGGTGCATTGTCTA
CAGATTCTATCGGTGATGCATTCGTTGAAGGTCACGAAGACCAAATGCTGGTTCAGCAGTTTGACCACAA
CGTGACAGTACCTACAGACCCTCAATCTGGGCAGCCTTCAGGTCAGCGTGTGCACAAGCCGTTCAAATTT
ACGGTAGCACTGAACAAAGCTGTTCCGTTGTTGTACAACGCATTGGCGTCTGGCGAGAAAATGAAATCTG
TTGAGTTGAAGTGGTACCGCACATCGATTGAAGGTAAACAAGAGAACTTCTTCACAACCTCTCTTGAGAG
CGCTTCTATCGTTGATATCCACTGTGAGATGCCACACTGTCAGGATCCAACAAACGCCGACTTCACGCAA
AACGTTACCGTTTCTCTGTCTTACCGCAAGATCAACTGGGATCACGTGAACGCTGGTACTTCAGGTTCAG
ACGACTGGCGTAAACCTGTCGAAGCATAA