SecReT6
Effector Protein ID: 549725694
-
SecReT6 ID857
T6SS typeA3
Gene symbol-
Locus tagSTMDT2_30251
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. DT2
Repliconchromosome [GenBank: NC_022544] [Browse all T6SS(s) in this replicon]
Location [Strand]3248713..3249198 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorROD_34191
DescriptionHcp protein
UniProt IDU4MFB7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.20E-38, Aligned region: 5..135
Protein Sequence: 161 a.a.     [Download]
>gi|549725694|ref|YP_008645884.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhimurium str. DT2]
MDAIFLKLDNIKGESQVEGFEDQIEIMSYSHNVAMQVNNDVSLTERTSGRAHVGEMSLTKFVDLATPVLN
EYCCSGRLIRTAVLTLCRNDDGKMRSLIVYTLTNVLISQLSVSGGAGGKPVETMSLNFTKIEWQITAEKS
DGAQQESRTSVWDLAMNQIGK
-
Nucleotide Sequence: 486 bp     [Download]
>gi|549722728|ref|NC_022544.1|:c3249198-3248713 Salmonella enterica subsp. enterica serovar Typhimurium str. DT2, complete genome
ATGGATGCGATTTTTTTAAAGCTCGACAATATCAAAGGCGAAAGCCAGGTTGAAGGCTTTGAAGATCAGA
TAGAGATCATGTCTTATAGCCACAATGTGGCAATGCAGGTAAATAACGATGTTAGCCTCACTGAGCGGAC
TTCCGGGCGCGCGCATGTTGGTGAAATGTCGCTCACCAAATTTGTCGACCTCGCCACGCCTGTGCTCAAT
GAGTACTGCTGTAGCGGGAGGCTAATTAGAACCGCGGTGCTGACGTTGTGCCGCAATGACGACGGCAAAA
TGCGGTCGCTTATCGTTTATACCCTGACAAACGTGCTGATATCACAACTCAGTGTTAGCGGCGGCGCCGG
CGGTAAGCCGGTGGAAACGATGTCGCTGAACTTCACGAAAATCGAATGGCAAATCACTGCCGAGAAATCA
GACGGCGCTCAGCAGGAGTCCAGAACGTCAGTATGGGATCTGGCGATGAACCAGATAGGGAAATGA