SecReT6
Effector Protein ID: 550899690
SecReT6 ID860
T6SS typeA3
Gene symbolsciK
Locus tagDT104_02751
StrainSalmonella enterica subsp. enterica serovar Typhimurium DT104
Repliconchromosome [GenBank: NC_022569] [Browse all T6SS(s) in this replicon]
Location [Strand]316892..317377 [+]
Producttype IV secretion system SciK protein
Effector typeProtein
Homologous effectorEvpC
DescriptionHcp protein
UniProt IDT2K420
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-41, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|550899690|ref|YP_008668782.1| type IV secretion system SciK protein [Salmonella enterica subsp. enterica serovar Typhimurium str. DT104]
MAYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSGLGSGKVSVTNLDFDHYIDRASPNLF
KYCASGKHIPQAILVMRKAGGNPLEYLKYTFTDLIVAVVSPSGSHDGEIASRETVELSFSTVKQEYVVQN
QQGGSGGTITAGYDFKANKEI
-
Nucleotide Sequence: 486 bp     [Download]
>gi|550899431|ref|NC_022569.1|:316892-317377 Salmonella enterica subsp. enterica serovar Typhimurium DT104 main chromosome, complete genome
ATGGCTTATGACATTTTTTTGAAAATTGACGGCATTGATGGCGAGTCAATGGATGACAAACACAAAAATG
AAATTGAAGTACTGAGCTGGCGCTGGAATATTCATCAGGAATCCACCATGCACGCCGGTAGCGGCCTCGG
CTCCGGTAAGGTCTCCGTCACCAACCTGGATTTTGATCACTATATCGACCGCGCCAGCCCGAACCTGTTC
AAATACTGCGCCTCCGGCAAGCACATTCCGCAGGCCATTCTGGTTATGCGTAAGGCTGGCGGCAATCCGC
TGGAGTACCTCAAGTATACCTTCACCGACCTGATTGTCGCCGTGGTTTCCCCGAGCGGCAGCCACGATGG
TGAAATCGCCTCCCGTGAAACGGTGGAGCTCTCCTTCAGCACCGTGAAGCAGGAATACGTGGTGCAGAAC
CAGCAGGGCGGCAGCGGCGGCACCATCACCGCAGGCTACGACTTCAAGGCCAACAAAGAAATTTAA