SecReT6
Effector Protein ID: 556554736
-
SecReT6 ID862
T6SS typeA2
Gene symbol-
Locus tagP423_15420
StrainEscherichia coli JJ1886
Repliconchromosome [GenBank: NC_022648] [Browse all T6SS(s) in this replicon]
Location [Strand]3139067..3139558 [+]
ProductHcp family type VI secretion system effector
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDU5SQS0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.90E-39, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|556554736|ref|YP_008723076.1| Hcp family type VI secretion system effector [Escherichia coli JJ1886]
MAIPAYLWLKDDGGADIKGSVDVQGREGSIEVVALDHDVYIPTDNNTGKLTGTRTHKPFTFTKEIDASSP
YLYKAVTTGQTLKTAEFKFYRINDAGQEVEYFNITLDNVKLVRVAPLMHDIKDPSREKHNHLERIEFRYE
KITWTYKDGNIIHSDSWNERPSA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|556550243|ref|NC_022648.1|:3139067-3139558 Escherichia coli JJ1886, complete genome
ATGGCTATTCCTGCTTATCTCTGGCTGAAAGATGACGGCGGCGCGGATATCAAAGGTTCCGTGGACGTTC
AGGGGCGCGAAGGTAGCATCGAAGTGGTGGCGCTGGATCACGATGTGTACATCCCGACCGACAACAACAC
CGGCAAACTGACCGGTACCCGTACTCACAAGCCCTTTACGTTTACCAAAGAAATCGATGCCTCCAGCCCG
TATCTCTACAAAGCTGTGACCACCGGCCAGACTCTGAAAACGGCAGAATTTAAGTTTTACCGCATCAACG
ATGCCGGTCAGGAAGTGGAGTACTTCAACATCACGCTTGATAACGTCAAGCTGGTCAGAGTCGCTCCGCT
TATGCACGACATCAAGGATCCTTCCAGAGAGAAGCATAACCACCTGGAACGTATTGAGTTCCGCTACGAG
AAAATCACCTGGACTTACAAAGACGGCAACATCATTCATTCCGACTCGTGGAATGAGCGTCCTTCCGCCT
GA