SecReT6
Effector Protein ID: 556573414
-
SecReT6 ID868
T6SS typeA4b
Gene symbol-
Locus tagBBK_5898
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome I [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]2978740..2980968 [+]
Productphage late control D family protein
Effector typeProtein
Homologous effectorBTH_I3225
Descriptiontype VI secretion system Vgr family protein
UniProt IDU5V3Z0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2345 [PF10106], Evalue: 1.90E-42, Aligned region: 430..462
DUF2345 [PF10106], Evalue: 1.90E-42, Aligned region: 514..665
T6SS_Vgr [PF13296], Evalue: 1.30E-38, Aligned region: 379..487
T6SS_Vgr [PF13296], Evalue: 1.30E-38, Aligned region: 554..619
Phage_GPD [PF05954], Evalue: 6.30E-28, Aligned region: 2..194
Phage_base_V [PF04717], Evalue: 9.50E-19, Aligned region: 278..362
Protein Sequence: 742 a.a.     [Download]
>gi|556573414|ref|YP_008742343.1| phage late control D family protein [Burkholderia pseudomallei NCTC 13179]
MRRLLRREGITVFAKAGPAKGERPLQGDAPVHTLVCCDDPMSLPQAPAGTVRLHPRDGGAAQRDTVTLFA
LRRQLAPGKAGRPSWDYKKARIDESSVASSLDQGEAGNDLAKLLTDIAIDIAHAGDSWRDHERLTRARML
AHEFEAERHDGVSSVRDLAVGTWITLTGDPQWDRQRVDKRQFVITSIDHDIWNNLPKGLNERVHALFAAS
RNLACAPRALPSALANDADTRYENTFTCVRRGVPLAPAYDPQADLPPAHLLTGTIVGAEGEEVFCDEDGR
VRVRVHGLDPADHAHAQGAGTNGNAGDSAPIRVASSLAGAYFGASFLPRVGMEVLLGCLGGDPDRLVIIG
VLGNGAHPPATFSHAGGLPGNRYLSGIKTKEIRGQRYNQLRLDDTPNQISAQLASEHAHPQLNLGYLTQP
RENGHGNDRGEGVELRTDAAAALRAAQGMLLTTYARTQASGGQLDRDELIRLLGECAELFKALGDYAGQH
GGQAVDTAGQHAVAAAFKRWAPGTDGADAPSDGAARALMAFGAQAGSVNVTPKTHVTYAGENIDQVAQQH
LQLMSGQRLNATAGQGMQLFARGAGVQAVAGEGPMLLQAQAGTLTANAQKGVKITTNEHEVFVSAPKIRL
VAEDGSYLELGGGITLGTNGDIKLLSASHQWGGPSTAQAAKSGFGNQPTDQRFKLHYPGEDGDLQAAANK
RFRITLDDGRVIEGKTDASGLTDLVKDDAMRIAKIDYLKPKL
-
Nucleotide Sequence: 2229 bp     [Download]
>gi|556571789|ref|NC_022658.1|:2978740-2980968 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
GTGCGCCGTCTGCTGCGCCGCGAAGGGATCACCGTGTTCGCGAAGGCGGGGCCGGCGAAGGGCGAACGGC
CGTTGCAGGGCGACGCGCCCGTGCACACGCTCGTGTGCTGTGACGATCCGATGTCGTTGCCGCAAGCGCC
GGCCGGCACGGTCCGCCTGCATCCGCGCGACGGCGGCGCCGCGCAGCGCGACACGGTCACGCTGTTCGCG
CTGCGTCGGCAATTGGCGCCCGGCAAGGCCGGGCGCCCGTCGTGGGACTACAAGAAGGCGCGGATCGACG
AATCGAGCGTCGCTTCGAGCCTCGATCAGGGCGAGGCGGGCAACGATCTGGCGAAGCTGCTGACCGACAT
CGCGATCGACATTGCGCACGCGGGCGATTCATGGCGCGATCACGAGCGGCTCACCCGCGCGCGCATGCTC
GCGCACGAGTTCGAAGCCGAGCGCCATGACGGCGTCAGCAGCGTGCGGGATCTCGCCGTGGGCACATGGA
TCACGCTGACGGGCGATCCGCAATGGGACAGGCAACGCGTCGACAAGCGTCAGTTCGTGATCACGTCGAT
CGATCACGACATCTGGAACAACCTGCCGAAGGGGCTCAACGAGCGCGTGCACGCGCTGTTCGCCGCGAGC
CGCAATCTCGCGTGCGCGCCCCGCGCGCTGCCGTCCGCGCTGGCGAACGACGCGGATACCCGCTACGAGA
ACACGTTCACGTGCGTGCGCCGCGGCGTGCCGCTTGCGCCCGCGTACGATCCGCAAGCCGATTTGCCGCC
CGCGCATCTGCTCACGGGCACGATTGTCGGCGCGGAGGGCGAAGAAGTGTTCTGCGACGAAGACGGCCGG
GTGCGCGTGCGGGTGCACGGCCTCGATCCGGCGGATCACGCGCACGCGCAGGGCGCGGGCACCAACGGCA
ACGCGGGCGACAGCGCGCCGATCCGCGTGGCGTCGAGCCTCGCCGGCGCCTATTTCGGCGCATCGTTTCT
GCCGCGAGTCGGCATGGAAGTCCTTCTCGGGTGTCTCGGCGGCGATCCGGACCGGCTGGTGATCATCGGC
GTGCTCGGTAACGGCGCGCATCCGCCGGCGACGTTCAGCCACGCGGGCGGGCTGCCGGGCAATCGCTACC
TGTCGGGCATCAAGACGAAGGAGATTCGTGGGCAACGGTACAACCAGCTGCGTCTCGACGACACGCCGAA
CCAGATCAGCGCGCAACTGGCGAGCGAGCACGCGCATCCGCAGCTCAATCTCGGATATCTGACGCAACCG
CGCGAGAACGGCCACGGGAACGACCGCGGCGAGGGCGTGGAGTTGCGTACCGACGCGGCGGCGGCGCTGC
GGGCGGCGCAAGGCATGCTGCTGACGACCTATGCGCGCACGCAGGCGAGCGGCGGGCAACTGGACCGTGA
CGAGCTGATTCGGTTGCTCGGCGAATGCGCGGAGCTGTTCAAGGCGCTGGGCGACTACGCGGGGCAGCAC
GGCGGGCAGGCCGTGGATACGGCCGGCCAGCACGCGGTGGCCGCCGCGTTCAAGCGCTGGGCGCCGGGCA
CGGACGGCGCCGATGCGCCGTCCGACGGCGCAGCGCGCGCGCTGATGGCGTTCGGCGCGCAGGCCGGTTC
GGTGAACGTCACGCCGAAGACGCATGTGACGTATGCCGGCGAGAACATCGATCAGGTCGCGCAGCAGCAC
CTGCAACTGATGAGCGGCCAGCGGCTGAACGCGACGGCCGGGCAGGGCATGCAGCTCTTCGCGCGGGGCG
CGGGGGTGCAGGCCGTGGCGGGCGAAGGGCCGATGCTGCTGCAGGCGCAAGCCGGCACGCTGACGGCGAA
CGCGCAGAAGGGCGTCAAGATCACGACGAACGAGCACGAGGTGTTCGTGAGCGCGCCGAAGATTCGGCTC
GTTGCCGAGGACGGCAGCTACCTCGAGCTCGGCGGCGGCATCACGCTCGGCACGAACGGCGACATCAAGC
TGCTGTCGGCGTCGCACCAGTGGGGCGGGCCGTCGACCGCGCAGGCGGCGAAGAGCGGGTTCGGCAATCA
GCCGACGGATCAGCGTTTCAAGCTGCACTATCCGGGCGAGGACGGCGATTTGCAGGCGGCGGCGAACAAG
CGGTTCCGGATCACGCTGGACGACGGGCGCGTCATCGAAGGCAAGACCGACGCGAGCGGCCTGACGGATC
TGGTCAAGGACGACGCGATGCGTATCGCGAAGATCGACTATCTGAAGCCGAAGCTCTGA