SecReT6
Effector Protein ID: 556573854
-
SecReT6 ID868
T6SS typeA4b
Gene symbol-
Locus tagBBK_5899
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome I [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]2980982..2983222 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I3226
Description
UniProt IDU5V575
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF3274 [PF11678], Evalue: 7.80E-120, Aligned region: 416..725
Abhydrolase_6 [PF12697], Evalue: 0.00015, Aligned region: 38..61
Abhydrolase_6 [PF12697], Evalue: 0.00015, Aligned region: 226..311
DUF900 [PF05990], Evalue: 0.0056, Aligned region: 37..46
DUF900 [PF05990], Evalue: 0.0056, Aligned region: 213..283
PGAP1 [PF07819], Evalue: 0.0072, Aligned region: 38..43
PGAP1 [PF07819], Evalue: 0.0072, Aligned region: 249..302
Thioesterase [PF00975], Evalue: 0.0087, Aligned region: 147..188
Thioesterase [PF00975], Evalue: 0.0087, Aligned region: 258..359
Protein Sequence: 746 a.a.     [Download]
>gi|556573854|ref|YP_008742344.1| hypothetical protein BBK_5899 [Burkholderia pseudomallei NCTC 13179]
MNGINDQCFTAARGAGVTMANRPGDRPVPIPRDLPGVVIFIHGVNDPGAAYATVERGLCQGLNERLSRSD
LRPGAYGGEYAEAIKAKDQKSPFFDSRIANDPDMYLYRRAETGGTHSMFLPFYWGYRASDDEIAKISHPG
EVKSRVADSDGNLMTRGQYQDIHGNRLDAHFGKGGGFFANATNNIPQMYSPGFEPDKLERTVMQNALAGN
TIFAGKSPDRRYFVLAAARLASLIRTIRAVRPSALALEHGMDPRHETITVMGHSQGTIITLLAQAMLKQQ
GQRCVDCIIMVDTPYSLQFTQDGSQQTGHAKLKTLVDIVNAVTSEPHTIPELAELMIDSAHSCGRAGQNW
SKTQGKRPDKGGKHWITFDERDNRGKVYLYFCPEDTVVGLDKVRGIGTFGVPDEVPADGAAASRGKTMPA
MTVLEPKRFFQRMWTRLERDQDGRGKRSKVAVGTPPARVPVRDPFQRLTPGPDTDGTMLGTLVESGKNMA
LQASFKRNDIRFINGEQLKPAYEPDLYGGEVRKGGQVPGHADVAGLMRPDDVTKNVALGNQYAKFKWKDV
ATTNDPGAGIEPHKQAFNRGRPVDEQSHNWRIVPSRSLGSMLSAAATGGRYQTYVIQREETPDEVRKRMR
TDADQLEANNYHSGVLLSSENHRWVTAMDVAIGQAVTLDDPDWRRLLLLMADWKMTPDAMDKIAKCNAYG
RLETHTREFIDACAKYYQNGSFPAEKFVPLTLPPLVTSELKVDKRA
-
Nucleotide Sequence: 2241 bp     [Download]
>gi|556571789|ref|NC_022658.1|:2980982-2983222 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGAACGGAATCAACGATCAGTGTTTCACCGCCGCCCGCGGGGCGGGCGTGACGATGGCGAATCGGCCCG
GCGACCGGCCCGTGCCGATTCCGCGCGATCTGCCGGGCGTGGTGATCTTCATCCACGGCGTCAACGATCC
CGGGGCGGCTTATGCCACCGTGGAGCGCGGGCTGTGCCAGGGGCTCAATGAGCGCTTGTCGCGAAGCGAT
CTGCGGCCGGGGGCGTATGGCGGGGAATATGCCGAAGCCATCAAAGCGAAAGACCAAAAGAGCCCGTTTT
TCGATAGCAGAATCGCCAACGATCCGGACATGTATCTGTATCGACGTGCGGAGACCGGCGGCACTCACAG
CATGTTCCTGCCGTTCTACTGGGGCTATCGGGCGTCCGATGACGAGATCGCGAAGATCAGCCATCCGGGC
GAGGTCAAGAGCCGCGTCGCGGACAGCGACGGCAACCTGATGACGCGCGGCCAGTATCAGGACATCCACG
GCAACCGGCTCGACGCCCATTTCGGCAAGGGCGGCGGGTTTTTCGCCAACGCGACGAACAACATCCCGCA
GATGTACAGCCCGGGCTTCGAACCGGACAAGCTGGAGCGCACGGTCATGCAAAACGCGCTGGCCGGCAAT
ACGATCTTCGCCGGCAAGTCGCCCGATCGCCGCTATTTCGTGCTGGCCGCGGCTCGCCTGGCGAGCCTCA
TCCGGACCATTCGGGCCGTCCGGCCTTCCGCGCTCGCGCTGGAGCACGGCATGGATCCTCGACACGAAAC
GATCACCGTGATGGGGCACAGCCAGGGCACGATCATCACGCTGCTCGCGCAGGCGATGCTCAAGCAGCAA
GGGCAGCGCTGCGTCGATTGCATCATCATGGTCGATACGCCGTACAGCCTGCAGTTCACCCAGGACGGCA
GCCAGCAAACCGGGCACGCGAAGCTCAAGACGCTGGTCGACATCGTCAACGCGGTGACGAGCGAGCCGCA
TACGATTCCGGAGCTGGCCGAACTGATGATCGATTCGGCCCATTCGTGCGGCCGGGCCGGACAGAACTGG
AGCAAGACGCAGGGAAAGCGGCCGGACAAGGGCGGCAAGCACTGGATCACGTTCGACGAGCGCGACAACC
GCGGCAAGGTCTATCTGTACTTTTGCCCGGAAGATACCGTGGTCGGCCTCGACAAGGTGCGGGGGATCGG
CACGTTCGGCGTGCCCGACGAGGTGCCGGCCGATGGCGCGGCGGCCAGCCGGGGCAAAACGATGCCCGCG
ATGACGGTGCTTGAGCCGAAGCGCTTCTTTCAGCGCATGTGGACGCGGCTCGAGCGCGACCAGGACGGCA
GGGGAAAGCGCTCGAAGGTCGCCGTCGGCACGCCGCCCGCGCGCGTGCCGGTTCGCGACCCGTTTCAGCG
ATTGACGCCGGGCCCCGACACAGACGGCACGATGCTTGGCACCTTGGTCGAATCCGGCAAGAACATGGCG
CTGCAGGCATCGTTCAAGCGCAACGACATTCGCTTCATCAACGGCGAGCAACTGAAACCGGCGTACGAGC
CCGATCTGTACGGGGGCGAGGTTCGGAAGGGCGGACAGGTGCCCGGGCATGCCGATGTCGCCGGGTTGAT
GCGTCCGGACGACGTGACGAAAAACGTCGCGCTCGGCAACCAGTACGCGAAGTTCAAATGGAAAGACGTC
GCGACGACGAACGATCCGGGCGCCGGCATCGAGCCGCACAAGCAGGCGTTCAATCGCGGCCGTCCGGTCG
ACGAGCAGTCGCATAACTGGCGCATCGTGCCGAGCCGGTCGCTCGGCTCGATGCTGTCGGCAGCCGCCAC
GGGCGGACGGTATCAGACGTACGTGATCCAGCGCGAGGAGACGCCGGACGAGGTTCGCAAGCGCATGCGC
ACCGATGCCGATCAACTGGAAGCGAACAACTATCATTCGGGCGTGCTGCTCAGTTCGGAGAACCATCGCT
GGGTCACGGCGATGGACGTGGCGATCGGCCAGGCGGTGACGCTGGATGATCCGGACTGGCGGCGGTTGTT
GCTTTTGATGGCGGATTGGAAGATGACGCCGGATGCAATGGATAAGATCGCGAAATGCAACGCTTATGGC
CGGCTTGAGACGCATACGAGGGAATTTATCGATGCGTGCGCGAAGTACTATCAAAACGGCTCGTTCCCTG
CGGAGAAGTTTGTGCCGCTTACTTTGCCACCACTCGTCACCAGCGAACTGAAAGTTGACAAGAGAGCATG
A