SecReT6
Effector Protein ID: 556573940
-
SecReT6 ID868
T6SS typeA4b
Gene symbol-
Locus tagBBK_4773
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome I [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]1571085..1571990 [+]
ProductD-mannose binding lectin family protein
Effector typeProtein
Homologous effectorBTH_II0310
Description
UniProt IDU5V677
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam B_lectin [PF01453], Evalue: 8.30E-11, Aligned region: 87..134
B_lectin [PF01453], Evalue: 8.30E-11, Aligned region: 190..229
Protein Sequence: 301 a.a.     [Download]
>gi|556573940|ref|YP_008741225.1| D-mannose binding lectin family protein [Burkholderia pseudomallei NCTC 13179]
MKKYALALWFMLVSSMSAMAGAIIPSGATLVAGQYAISNNGNFAFGVDAASGKLYFHYRFPTQAWGASAM
SQMYGTQPEGALYVGKGDRLVMQTDGRLVFYSGNDVVWSNWYYGPAPVPGSYAVVEDFGVVAIYPPQGGY
PTFTWPFASVTPNSGALATVVGYPFGVNFPVLNGRQWLQIFNNVTYYLWNKSFAADSVAMQTDGNLVVYN
KGQPVWSTGTSGNPGAYMLVTPVGFVLGKQYGGILANVPYPVSVDQSSRASGPNDPKPTPAAPPPPSLNL
PINASWKCYYVKDWLACYAPG
-
Nucleotide Sequence: 906 bp     [Download]
>gi|556571789|ref|NC_022658.1|:1571085-1571990 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGAAAAAATACGCATTGGCGCTCTGGTTCATGCTGGTTTCATCAATGTCGGCAATGGCGGGGGCGATCA
TTCCATCGGGCGCAACGCTGGTTGCGGGGCAATACGCGATATCGAACAACGGCAACTTCGCGTTCGGCGT
CGACGCCGCCAGCGGCAAGCTCTATTTCCACTACAGGTTCCCGACGCAGGCGTGGGGCGCGAGCGCGATG
TCGCAAATGTACGGAACGCAGCCCGAGGGCGCGCTCTACGTCGGCAAGGGCGACCGGCTCGTGATGCAGA
CCGACGGGCGGCTCGTGTTCTATTCGGGCAACGACGTCGTCTGGAGCAACTGGTATTACGGCCCCGCGCC
GGTCCCCGGCTCGTATGCGGTCGTCGAGGATTTCGGCGTCGTCGCGATCTATCCGCCGCAGGGCGGCTAT
CCGACGTTCACCTGGCCGTTCGCGTCGGTCACGCCGAACAGCGGCGCGCTCGCGACGGTGGTCGGCTATC
CGTTCGGCGTGAACTTCCCGGTGCTCAACGGGCGCCAATGGCTGCAGATCTTCAACAACGTCACTTACTA
CCTGTGGAACAAGAGCTTCGCCGCGGACAGCGTCGCGATGCAGACCGACGGCAATCTCGTCGTCTACAAC
AAGGGGCAGCCGGTCTGGTCGACGGGAACGTCGGGCAATCCGGGCGCCTACATGCTGGTGACGCCTGTCG
GCTTCGTGCTCGGCAAGCAGTACGGCGGCATCCTCGCGAACGTGCCCTACCCGGTGTCCGTCGATCAGTC
GAGCCGCGCGAGCGGCCCGAACGATCCGAAGCCGACGCCGGCCGCGCCGCCGCCGCCCTCGCTGAACCTG
CCGATCAATGCGAGCTGGAAGTGCTATTACGTGAAGGACTGGCTCGCGTGCTACGCGCCGGGTTGA