SecReT6
Effector Protein ID: 556576181
-
SecReT6 ID868
T6SS typeA4b
Gene symbol-
Locus tagBBK_87
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome I [GenBank: NC_022659] [Browse all T6SS(s) in this replicon]
Location [Strand]113366..116206 [-]
ProductRhs element Vgr family protein
Effector typeProtein
Homologous effectorBTH_I2693
Descriptiontype VI secretion system Vgr family protein
UniProt IDU5UY40
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.30E-61, Aligned region: 42..355
Phage_GPD [PF05954], Evalue: 6.30E-61, Aligned region: 553..553
DUF2345 [PF10106], Evalue: 1.40E-40, Aligned region: 748..912
T6SS_Vgr [PF13296], Evalue: 8.10E-26, Aligned region: 587..690
T6SS_Vgr [PF13296], Evalue: 8.10E-26, Aligned region: 795..832
Phage_base_V [PF04717], Evalue: 5.90E-12, Aligned region: 442..546
Protein Sequence: 946 a.a.     [Download]
>gi|556576181|ref|YP_008742696.1| Rhs element Vgr family protein [Burkholderia pseudomallei NCTC 13179]
MSIPTDVLQALFGGWSQHDRFLWITTPLGANALVAESLHGWEALDDGGFRLQLTALAEHPSLPLAQLIGA
PILIEWQAQEGRDARRPLHGHVIAAELVGYNGGLARVRLVVEPWLTLLRQRVDSYNYLDASVVEISEQVF
RRYARGAIAPAWRWALADAAKYPKRSLTAQAGESDFDFLERLWAEEGIFYWFEHEGDARASSLGKHTLVL
ADSNQRFAPDEPEIVGFHQTSDDDPQGCIQHFMHARRWRIGSVARASWDHRSLSTRPTGARANGAVAPGE
DRDVAGPYAYQTGAIGDRRAQQQLDAQRVAALRSEGRSTRRDLRPGLRFAIAHHPTLGVSDAFICLRVEH
SARANVDATVRSAIEQRLGAIASIAGAAPVPHGPASALNAALGADTHHGGSLMQDDAVYRNRFVALPAEQ
TYRPLAASGHGARMHPVAVMPGAQTAIVVGAGDPVHTDRDHRIRIQHHAQRGENAASRDDHPHAANAPAN
RGAGTWTRMMTPVGGDNWGGVSVPRVGQEVWTEWLEGQPDRPVAVAALYNGRGNAHAQHNAQAGGPSGST
GNAAAWFAGNAHAAVLTGFKTQDMSMSQQGTGGYRQFMLDDTAGQSSARLYTTDRNSGLTLGHVKQTQDN
RRQADRGYGAELATDAAGALRGGAGLLISTAPGVSQMDASAPSQVLAQHRQTLQSLAALAYKQGAEPGGA
VPEAAGGAGAASASTGAAADKPLPAVDGIEQSRDAIGATREGSGGDTAGGGGGGAIAWSKPHLVAHGEAG
LAAMSAKSHVWVSGTETVLSAGQDVQLTAKGKTSVVANHGISLYTQGAAGDGRPVAGRGIALHAASGAVS
MQAQNAGKLSASAQKAVTLASAQGSASVQAQQRVLLSAAKAYLKMEGNDIVVGAPGRADFKAAAHQLTGP
KSAGASAQMPKSEPKLCEYKTRAADVAHEGTMKSAA
-
Nucleotide Sequence: 2841 bp     [Download]
>gi|556574580|ref|NC_022659.1|:c116206-113366 Burkholderia pseudomallei NCTC 13179 chromosome 1, complete sequence
ATGTCGATCCCCACTGACGTTCTGCAAGCACTCTTCGGCGGCTGGTCGCAACACGACCGCTTTCTCTGGA
TCACGACGCCGCTCGGCGCGAACGCGCTCGTCGCGGAAAGCCTGCACGGCTGGGAGGCGCTCGACGATGG
CGGCTTCCGTTTGCAGCTCACCGCGCTCGCCGAGCATCCGTCGCTGCCGCTCGCGCAACTGATCGGCGCG
CCGATCCTGATCGAATGGCAGGCGCAGGAAGGGCGCGACGCGCGCCGGCCGCTCCACGGCCACGTGATCG
CCGCCGAGCTCGTCGGCTACAACGGCGGCCTCGCACGCGTGCGGCTCGTCGTCGAGCCGTGGCTCACGCT
GTTGCGGCAGCGCGTCGACAGCTACAACTATCTGGACGCGAGCGTCGTCGAGATCAGCGAACAGGTGTTC
CGCCGTTACGCGCGCGGCGCGATCGCGCCCGCATGGCGATGGGCGCTCGCCGATGCGGCGAAGTACCCGA
AGCGCAGCTTGACCGCGCAAGCCGGCGAGTCCGATTTCGACTTCCTCGAGCGGCTCTGGGCGGAGGAGGG
CATCTTCTACTGGTTCGAGCACGAAGGCGACGCGCGCGCATCGAGCCTCGGCAAGCACACGCTCGTGCTC
GCCGATTCGAATCAGCGCTTCGCGCCGGACGAACCGGAGATCGTCGGCTTTCATCAGACGAGCGACGACG
ACCCGCAAGGCTGCATCCAGCACTTCATGCACGCGCGGCGTTGGCGCATCGGCAGCGTCGCGCGCGCGAG
CTGGGATCACCGCAGCCTGTCGACGCGTCCGACGGGCGCGCGCGCGAACGGCGCGGTCGCGCCGGGCGAG
GATCGCGACGTCGCGGGCCCGTACGCATACCAGACGGGCGCGATCGGAGACCGGCGCGCGCAGCAGCAAC
TCGACGCCCAGCGCGTGGCCGCGCTGCGGAGCGAAGGCCGCAGCACGCGCCGCGATCTGCGGCCCGGGCT
GCGTTTTGCGATCGCGCATCATCCGACGCTCGGCGTATCGGATGCGTTCATCTGCCTGCGCGTCGAGCAT
TCGGCGCGCGCGAACGTCGACGCGACCGTGCGCAGCGCGATCGAACAGCGCCTCGGCGCGATTGCGTCGA
TCGCCGGCGCCGCGCCGGTGCCGCATGGCCCCGCGAGCGCGCTGAACGCGGCGCTCGGCGCCGATACGCA
TCACGGCGGATCGCTGATGCAGGACGACGCCGTCTATCGCAATCGCTTCGTCGCGTTGCCCGCCGAGCAG
ACGTATCGGCCGCTCGCCGCATCCGGCCATGGCGCGCGCATGCACCCGGTCGCCGTGATGCCGGGGGCGC
AGACGGCGATCGTCGTGGGCGCGGGCGATCCCGTTCACACCGACCGGGATCACCGGATTCGCATCCAGCA
CCACGCGCAGCGCGGCGAGAATGCGGCGAGCCGCGACGATCACCCGCATGCGGCGAACGCGCCGGCGAAC
CGTGGCGCGGGCACGTGGACGCGGATGATGACGCCCGTGGGCGGCGATAACTGGGGTGGGGTGAGCGTGC
CGCGCGTCGGGCAGGAAGTGTGGACCGAATGGCTCGAAGGCCAGCCCGACCGGCCGGTTGCGGTGGCCGC
GCTCTACAACGGCCGCGGCAACGCGCACGCGCAGCACAACGCGCAGGCGGGAGGGCCGAGCGGCAGCACC
GGCAATGCGGCCGCATGGTTTGCCGGCAATGCGCATGCGGCGGTGCTGACGGGTTTCAAGACGCAGGACA
TGAGCATGAGCCAGCAAGGCACGGGCGGCTATCGGCAATTCATGCTCGACGATACGGCGGGCCAGTCGAG
CGCGCGCCTGTACACGACGGACCGCAACAGCGGGCTCACGCTCGGGCACGTGAAGCAGACGCAGGACAAC
CGGCGCCAGGCCGATCGCGGCTATGGCGCGGAACTGGCGACGGATGCCGCCGGCGCGCTGCGCGGCGGCG
CGGGGCTCTTGATCAGCACGGCGCCCGGCGTGAGCCAGATGGATGCGAGCGCGCCGAGCCAGGTGCTCGC
TCAGCATCGACAAACGTTGCAAAGCCTCGCGGCGCTCGCGTACAAGCAGGGCGCGGAGCCGGGCGGTGCG
GTGCCCGAGGCGGCGGGCGGAGCGGGCGCGGCGTCGGCGTCGACGGGGGCGGCGGCGGACAAGCCTTTGC
CGGCCGTCGATGGCATCGAGCAGAGCCGTGACGCGATCGGCGCGACGCGTGAAGGAAGCGGCGGCGATAC
GGCAGGCGGCGGGGGCGGCGGCGCGATTGCGTGGAGCAAGCCGCATCTCGTCGCACACGGCGAGGCGGGG
CTGGCCGCGATGTCGGCGAAGAGCCACGTGTGGGTGTCGGGTACCGAGACGGTGTTGAGCGCCGGACAGG
ACGTGCAATTGACGGCGAAGGGCAAGACGAGCGTCGTCGCGAATCACGGCATCTCGCTGTATACGCAGGG
CGCGGCGGGCGACGGGCGGCCGGTTGCCGGCCGGGGCATCGCGTTGCACGCGGCGTCCGGCGCGGTGAGC
ATGCAAGCGCAGAACGCTGGCAAGCTGAGCGCGAGCGCGCAGAAGGCGGTGACGCTCGCGAGCGCGCAAG
GCAGCGCGTCCGTGCAGGCGCAGCAGCGCGTCCTGCTGAGCGCGGCGAAGGCCTATCTGAAGATGGAAGG
CAACGACATCGTCGTCGGCGCGCCGGGGCGCGCGGATTTCAAGGCGGCGGCGCATCAGTTGACGGGGCCG
AAGAGCGCGGGGGCGTCAGCGCAAATGCCGAAGAGCGAACCGAAGCTGTGCGAGTACAAGACGCGCGCAG
CCGACGTTGCTCACGAAGGCACGATGAAGTCGGCGGCTTGA